Reset
Rank Company Name AddressFULL Address Suburb Zone State PostCode Phone Website Email Mobile ABN ACN GST Industry Conversion Rate ConversionRateCat OnlinePresence ReviewsCount GoogleRating B2B B2C Short Summary Description Technologies enrichment_source_email enrichment_source_website enrichment_source_abn enrichment_date enrichment_status enrichment_phase Overall Business Details Techno Stack Listings Website Performance SEO Online Reputation Google Tag Manager Google Analytics Pixel Google Ads Pixel Google Ads Review Replies % Domain Place ID Verified_Name Verified_Email Verified_Phone Verified_Address Verified_ABN GoogleRatingverifiee Verified_ACN Verified_GST Verification_Status_Name Verification_Status_Email Verification_Status_Phone Verification_Status_Address enrichment_source OptOut
5501 Coutts Redington Chartered Accountants Shop 4/278 Ross River Rd, Aitkenvale QLD 4814 Shop 4/278 Ross River Rd Aitkenvale Townsville QLD 4814.0 (07) 4796 0888 https://www.couttsredington.com.au mail@couttsredington.com.au 43 244 213 166 928089271 Accounting 85.0 Very High Strong 3.0 4.0 True True So in summary, Coutts Redington Chartered Accountants has a solid presence in Aitkenvale's area with a 4-star rating and 3 reviews. The overall score of 70 reflects a well-rounded digital presence. The conversion rate is very high at 85, making this an excellent prospect. To improve, consider building more reviews. We could easily help you to improve this, let's talk about it. Coutts Redington Chartered Accountants is a professional accounting firm in Aitkenvale, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 4/5 with 3 reviews. Website available. WordPress, GA generated 2026-03-21 12:14:49 completed free_enrichment_v1 free_enrichment_script
5502 Davis Accounting 31-33 Fleming St, Aitkenvale QLD 4814 31-33 Fleming St Aitkenvale Townsville QLD 4814.0 (01) 4069 7353 https://davisaccountingservices.com.au info@davisaccountingservices.com.au 0406 973 538 76 438 369 913 Accounting 85.0 Very High Strong 3.0 5.0 True True So in summary, Davis Accounting has a strong foundation in Aitkenvale's area with a 5-star rating and 3 reviews, indicating satisfied clients. However, there are key areas for improvement, particularly in tech stack (15), which are affecting the overall score of 67. The conversion rate is very high at 85, making this an excellent prospect. To improve, consider upgrading the tech stack, building more reviews. We could easily help you to improve this, let's talk about it. Davis Accounting is a professional accounting firm in Aitkenvale, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 5/5 with 3 reviews. Website available. generated 2026-03-21 12:14:49 completed free_enrichment_v1 free_enrichment_script
5503 Ezytax Blue - Townsville T111/330 Ross River Rd, Aitkenvale QLD 4814 T111/330 Ross River Rd Aitkenvale Townsville QLD 4814.0 (07) 3102 3630 https://www.ezytaxblue.com.au ezytax@ezytaxblue.com.au 58 781 560 991 452189069 Accounting 89.0 Very High Strong 22.0 3.0 True True So in summary, Ezytax Blue - Townsville has a presence in Aitkenvale's area with a 3-star rating and 22 reviews. The overall score of 71 reflects a well-rounded digital presence. The conversion rate is very high at 89, making this an excellent prospect. To improve, consider upgrading the tech stack. We could easily help you to improve this, let's talk about it. Ezytax Blue - Townsville is a professional accounting firm in Aitkenvale, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 3/5 with 22 reviews. Website available. Wix, GA generated 2026-03-21 12:14:49 completed free_enrichment_v1 free_enrichment_script
5504 H&R Block Tax Accountants - Aitkenvale, Townsville Shop 1/276 Ross River Rd, Aitkenvale QLD 4814 Shop 1/276 Ross River Rd Aitkenvale Townsville QLD 4814.0 (07) 4767 5199 https://www.hrblock.com.au/locator/qld/townsville contact@hrblock.com.au 29 254 680 910 170289876 Accounting 90.0 Very High Strong 2.0 3.8 True True So in summary, H&R Block Tax Accountants - Aitkenvale, Townsville has a presence in Aitkenvale's area with a 3.8-star rating and 2 reviews. The overall score of 72 reflects a well-rounded digital presence. The conversion rate is very high at 90, making this an excellent prospect. To improve, consider building more reviews. We could easily help you to improve this, let's talk about it. H&R Block Tax Accountants - Aitkenvale, Townsville is a professional accounting firm in Aitkenvale, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 3.8/5 with 2 reviews. Website available. GTM, GA website_domain generated 2026-03-21 12:14:49 completed free_enrichment_v1 free_enrichment_script
5505 Taxation Services NQ 2/48 Thuringowa Dr, Kirwan QLD 4817 2/48 Thuringowa Dr Kirwan Townsville QLD 4817.0 (07) 4751 5311 https://www.taxationservicesnq.com.au contact@taxationservicesnq.com.au 78 165 740 455 751306507 Accounting 80.0 More Likely Strong 1.0 4.6 True True So in summary, Taxation Services NQ has a strong foundation in Kirwan's area with a 4.6-star rating and 1 reviews, indicating satisfied clients. The overall score of 70 reflects a well-rounded digital presence. The conversion rate of 80 is strong, indicating good potential. To improve, consider upgrading the tech stack, building more reviews. We could easily help you to improve this, let's talk about it. Taxation Services NQ is a professional accounting firm in Kirwan, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 4.6/5 with 1 reviews. Website available. GA website_domain generated 2026-03-21 12:14:49 completed free_enrichment_v1 free_enrichment_script
5506 Concord Tax Kirwan Townsville Tax Accountants - CPA 60 Thuringowa Dr, Kirwan QLD 4817 60 Thuringowa Dr Kirwan Townsville QLD 4817.0 (07) 4773 4088 https://www.concord.tax contact@concord.tax 18 790 872 661 Accounting 85.0 Very High Strong 5.0 4.4 True True So in summary, Concord Tax Kirwan Townsville Tax Accountants - CPA has a solid presence in Kirwan's area with a 4.4-star rating and 5 reviews. The overall score of 75 reflects a well-rounded digital presence. The conversion rate is very high at 85, making this an excellent prospect. To improve, consider building more reviews. We could easily help you to improve this, let's talk about it. Concord Tax Kirwan Townsville Tax Accountants - CPA is a professional accounting firm in Kirwan, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 4.4/5 with 5 reviews. Website available. WordPress, GTM, GA website_domain generated 2026-03-21 12:14:49 completed free_enrichment_v1 free_enrichment_script
5507 PRM Accounting 29 Thuringowa Dr, Kirwan QLD 4817 29 Thuringowa Dr Kirwan Townsville QLD 4817.0 (07) 4426 1815 https://www.prmaccounting.com.au michelle@prmaccounting.com.au 57 160 881 441 310367044 Accounting 83.0 Very High Strong 21.0 5.0 True True So in summary, PRM Accounting has a strong foundation in Kirwan's area with a 5-star rating and 21 reviews, indicating satisfied clients. The overall score of 78 reflects a well-rounded digital presence. The conversion rate is very high at 83, making this an excellent prospect. We could easily help you to improve this, let's talk about it. PRM Accounting is a professional accounting firm in Kirwan, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 5/5 with 21 reviews. Website available. WordPress, GA generated 2026-03-21 12:14:49 completed free_enrichment_v1 free_enrichment_script
5508 Maclean Partners - Accountants & Advisers 20 Mill St, Charters Towers City QLD 4820 20 Mill St Charters Towers City Charters Towers QLD 4820.0 (01) 7478 8280 https://www.macleanpartners.com.au mpca@macleanpartners.com.au 34 658 368 108 902633847 Accounting 90.0 Very High Strong 1253.0 4.7 True True So in summary, your business has a strong foundational online presence, particularly in local visibility and reputation. Your Google Business Profile is excellent, with a 4.7-star rating from over 1,250 reviews, and your business listings are perfectly complete at 100. This indicates high trust and local search visibility for clients seeking accounting services in Charters Towers. However, your major weakness is a critically low Tech Stack score of 15, suggesting missing analytics and conversion tracking tools. This makes measuring marketing ROI and understanding client website behavior nearly impossible. Additionally, your website performance and SEO scores are only adequate, which may hinder converting your strong reputation into tangible leads. My one clear recommendation is to immediately implement a robust analytics setup, like Google Tag Manager, to track website conversions and user journeys. This data is essential to inform and justify all future marketing and website improvements, turning your strong visibility into measurable growth. Maclean Partners - Accountants & Advisers is a professional accounting firm in Charters Towers City, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:49 completed free_enrichment_v1 free_enrichment_script
5509 Agri Tax Accountants 63 Gill St, Charters Towers City QLD 4820 63 Gill St Charters Towers City Charters Towers QLD 4820.0 (02) 6521 5263 https://www.agritaxaccountants.com.au agritaxaccountants@company.com.au 13 491 100 850 Accounting 90.0 Very High Moderate 5.0 4.2 True True So in summary, your business, Agri Tax Accountants, has a solid foundation in local visibility and client trust. Your Google rating of 4.2 stars from 5 reviews is a strong asset, indicating good customer satisfaction. Your Business Details and Listings scores are reasonably healthy at 70 and 65 respectively, suggesting your core contact information is accessible online. However, a major weakness lies in your technological setup, with a critically low Tech Stack score of 15. This severely limits your ability to track marketing performance, understand customer journeys, and likely impacts conversion readiness. Furthermore, the absence of a live website is a significant risk, crippling your SEO potential and professional credibility for both your B2B and B2C audiences. My primary recommendation is to immediately develop a professional, mobile-optimized website with clear service pages and client testimonials, then implement foundational tracking like Google Analytics and Tag Manager to measure and improve your marketing effectiveness. Establishing this digital hub is the single most impactful step you can take to convert your good reputation into consistent growth. generated_from_name generated_from_name generated 2026-03-21 12:14:49 completed free_enrichment_v1 free_enrichment_script
5510 Cosca Charters Towers Tower 4B 2/6 Ben La, Queenton QLD 4820 Tower 4B 2/6 Ben La Queenton Charters Towers QLD 4820.0 (01) 1800 2838 https://www.cosca.com.au info@cosca.com.au 12 560 586 399 Accounting 90.0 Very High Strong 1.0 5.0 True So in summary, your business has a strong foundational online presence in key areas. Your perfect 5-star Google rating from your clients is a significant asset, and your Business Details and Listings scores are high at 90 and 80 respectively, meaning your core contact information is accurate and visible across the web. Your website is performing adequately and your online reputation score is solid. However, the data reveals a critical vulnerability: your Tech Stack score is extremely low at 15. This indicates your website likely lacks essential marketing and analytics tools, such as conversion tracking or a CRM, making it impossible to measure how visitors interact with your site or where your leads originate. Furthermore, your SEO score of 60 shows room for improvement in how you are found organically in search. To immediately address this blind spot and start converting your good visibility into measurable business growth, you must install and configure fundamental analytics tracking, such as Google Analytics 4 and conversion event tracking, on your website. This one action will provide the data needed to make informed decisions on all other marketing investments. Cosca Charters Towers is a professional accounting firm in Queenton, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:50 completed free_enrichment_v1 free_enrichment_script
5511 BCA Advisory Services Box 810/17 Gill St, Charters Towers City QLD 4820 Box 810/17 Gill St Charters Towers City Charters Towers QLD 4820.0 (01) 4197 1976 https://bcaadvisory.com.au robyn@bcaadvisory.com.au +61419719769 85 298 334 636 794062573 Accounting 62.0 More Likely Strong 30.0 5.0 True So in summary, your business, BCA Advisory Services, has a strong foundational online presence. Your perfect 5-star Google rating from 30 reviews is a major asset, demonstrating excellent client satisfaction and building significant trust. Furthermore, your business listings are impeccably managed with a 100 score, ensuring you are easy to find locally in Charters Towers, and your basic business details are accurately presented. However, your primary weakness is a critically underdeveloped technical foundation, with a tech stack score of only 15. This severely limits your ability to track website visitors, understand client behaviour, and measure marketing effectiveness. Your website performance and SEO scores are also moderate, indicating potential issues with site speed and visibility in search results, which could be hindering new client acquisition. Our single most important recommendation is to immediately implement a robust analytics and tracking setup, such as Google Tag Manager, on your website. This foundational step will provide the crucial data needed to systematically improve your site's performance, refine your SEO, and convert more of your excellent reputation into tangible business growth. BCA Advisory Services is a professional accounting firm in Charters Towers City, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:50 completed free_enrichment_v1 free_enrichment_script
5512 Cosca Ingham High Park Shopping Centre, Shop 3, 72/80 Herbert St, Ingham QLD 4850 High Park Shopping Centre, Shop 3, 72/80 Herbert St Ingham Ingham QLD 4850.0 (01) 7477 6217 https://cosca.com.au info@cosca.com.au 42 505 816 699 Accounting 90.0 Very High Strong 31.0 3.8 True So in summary, your business, Cosca Ingham, has a solid foundation online. Your business details are excellent at 90, and your listings are perfectly managed with a 100 score, ensuring good local visibility. Your online reputation score of 71 and Google rating of 3.8 stars from over 30 reviews indicate a base of client trust in your accounting services. However, a critical weakness is your very low Tech Stack score of 15, suggesting your website likely lacks essential marketing and analytics tools for tracking performance and conversions. Your SEO score is also a moderate 60, and website performance is at 70, which means you are missing opportunities to attract and efficiently serve potential clients searching online. My strongest recommendation is to immediately implement a core analytics suite like Google Tag Manager and Google Analytics on your website to diagnose conversion issues, then use those insights to systematically improve your site speed and on-page SEO for key services like tax and BAS. This data-driven fix is the essential first step to turning your online presence into a growth engine. Cosca Ingham is a professional accounting firm in Ingham, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:50 completed free_enrichment_v1 free_enrichment_script
5513 Leonardi Accountants 11-13 Lannercost St, Ingham QLD 4850 11-13 Lannercost St Ingham Ingham QLD 4850.0 (01) 7477 6124 https://www.leonardiaccountants.com.au enquiries@leonardiaccountants.com.au 44 104 735 253 Accounting 90.0 Very High Strong 1.0 5.0 True True So in summary, your business, Leonardi Accountants, has a strong foundational online presence. You have an excellent Google Rating of 5, a high Business Details Score of 90, and a solid Listings Score of 80, indicating good local visibility and a trusted reputation in the Ingham community. Your website is operational and performing at a reasonable level. However, your primary weakness is a critically low Tech Stack Score of 15, which severely limits your ability to track marketing performance and understand client behaviour. This gap makes it difficult to measure what drives leads and conversions. Additionally, your SEO Score of 60 suggests there is significant room for improvement in how you are found online by potential clients searching for accounting services. My one clear recommendation is to immediately implement and configure essential website tracking tools, like Google Analytics and Tag Manager. This will provide the data needed to make informed decisions to improve your website's conversion effectiveness and refine your SEO strategy, turning your strong reputation into measurable business growth. Leonardi Accountants is a professional accounting firm in Ingham, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:50 completed free_enrichment_v1 free_enrichment_script
5514 Stokes & Company 114 Lannercost St, Ingham QLD 4850 114 Lannercost St Ingham Ingham QLD 4850.0 (01) 7477 6338 https://www.stokesco.com.au admin@stokesco.com.au 74 824 996 654 323013182 Accounting 90.0 Very High Strong 4.0 3.8 True So in summary, your business, Stokes Company, has a solid foundation for local visibility. Your Business Details score of 90 and Listings score of 80 show strong, accurate local directory presence, which is crucial for an accounting firm in Ingham. You also have a credible Google Rating of 3.8 stars based on 4 reviews, and a decent website performance score of 70. However, the data reveals significant operational risks. Your Tech Stack score is critically low at 15, strongly suggesting missing essential tools like analytics or conversion tracking, so you're likely flying blind on how clients find and use your site. Furthermore, your SEO is only at 60, limiting your visibility in organic search, and the online reputation score of 66 indicates room to proactively manage and grow your reviews. My primary recommendation is to immediately audit and implement a core tech stack, starting with Google Analytics and Tag Manager, to track website conversions and user behaviour. This single action will provide the data needed to systematically improve your SEO and client acquisition. Stokes & Company is a professional accounting firm in Ingham, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:50 completed free_enrichment_v1 free_enrichment_script
5515 Carey Group Ingham 73-81 Lannercost St, Ingham QLD 4850 73-81 Lannercost St Ingham Ingham QLD 4850.0 (01) 7477 6720 https://careygroup.com.au/ingham info@careygroup.com.au 15 866 344 570 708254975 Accounting 90.0 Very High Strong 1.0 5.0 True So in summary, your business has a strong local reputation, evidenced by a perfect 5 Google rating and a high Online Reputation score of 83. Your Business Details Score is excellent at 90, and your Listings Score is solid at 80, indicating good foundational visibility in directories and on maps for your accounting services in Ingham. However, your main weakness is a critically low Tech Stack Score of 15, which suggests missing analytics and conversion tracking tools, severely hindering your ability to measure marketing performance. Your Website Performance and SEO Score are also moderate at 70 and 60 respectively, indicating potential speed issues and missed opportunities to attract more organic search traffic. My one clear recommendation is to immediately implement a robust analytics setup, like Google Tag Manager, to track website conversions and user behavior; this data is essential to diagnose your site's performance and SEO gaps, forming the basis for all other online improvements. Carey Group Ingham is a professional accounting firm in Ingham, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:50 completed free_enrichment_v1 free_enrichment_script
5516 Accounting @ Mission Shop 8/46-48 Porter Promenade, Mission Beach QLD 4852 Shop 8/46-48 Porter Promenade Mission Beach Mission Beach QLD 4852.0 (01) 7408 8633 https://www.aamission.com.au info@aamission.com.au 31 315 468 394 614792195 Accounting 42.0 Moderate Strong 153.0 5.0 True True So in summary, your business, Accounting Mission, has a strong local foundation. Your perfect Google listing score of 100 and outstanding 5-star rating from 153 reviews demonstrate excellent local visibility and a highly trusted reputation, which is crucial for both your B2B and B2C clients in Mission Beach. Your business details are also well-maintained with a 90 score. However, your tech stack score of 15 is a critical weakness, indicating your website likely lacks essential tools for tracking visitor behavior and measuring marketing effectiveness. Combined with a moderate website performance score of 70 and an SEO score of 60, this means you are missing opportunities to convert online interest into leads and may be losing visibility in broader searches. My primary advice is to immediately implement a robust analytics setup, like Google Tag Manager, on your website. This single action will unlock the data you need to understand your audience and systematically improve your site's performance and SEO, turning your strong local reputation into measurable business growth. Accounting @ Mission is a professional accounting firm in Mission Beach, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:50 completed free_enrichment_v1 free_enrichment_script
5517 KLP Taxation 52 Holland St, Wongaling Beach QLD 4852 52 Holland St Wongaling Beach Mission Beach QLD 4852.0 (01) 7406 8936 https://www.klptaxation.com.au info@klptaxation.com.au 57 495 625 374 Accounting 90.0 Very High Strong 3.0 5.0 True True So in summary, your business, KLP Taxation, has a solid foundation for local trust and visibility. You have an excellent 5-star Google rating and a high Business Details Score of 90, meaning your core contact information is accurate and easy to find online. Your Listings Score of 80 and decent Online Reputation of 83 further show you are well-presented and regarded in the Mission Beach community. The primary critique is your severely underdeveloped digital infrastructure, indicated by a very low Tech Stack Score of 15. This major gap likely means your website lacks essential tools for tracking visitor behaviour, measuring marketing effectiveness, and converting interest into client leads. Your SEO Score of 60 also suggests your online content isn't fully optimised to attract new searches. My top advice is to immediately implement a foundational analytics and conversion toolkit, starting with Google Tag Manager. This single action will allow you to track how clients find and use your site, directly addressing the tech gap and providing the data needed to systematically improve your SEO and conversion rates. KLP Taxation is a professional accounting firm in Wongaling Beach, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:50 completed free_enrichment_v1 free_enrichment_script
5518 FNQ Accounting 51 Butler St, Tully QLD 4854 51 Butler St Tully Tully QLD 4854.0 (01) 7406 8268 https://www.fnqaccounting.com.au fnqaccounting@company.com.au 16 829 934 897 Accounting 90.0 Very High Moderate 4.0 5.0 True True So in summary, your business, FNQ Accounting, has a strong foundation for local visibility and trust. Your perfect 5-star Google rating from 4 reviews is a major asset, and your Business Details and Listings scores of 80 show good local directory presence. Your website performance is also decent at 70, which aids user experience. However, a critical weakness is your very low Tech Stack score of 15, indicating you likely lack essential tracking and conversion tools like Google Analytics or Tag Manager. This makes measuring marketing effectiveness impossible. Furthermore, your SEO score of 60 suggests untapped potential for attracting more organic search traffic. To immediately address this blind spot and start making data-driven decisions, I strongly advise implementing and correctly configuring Google Analytics and Google Tag Manager on your website. This one step will unlock the insights needed to strategically grow your online presence. generated_from_name generated_from_name generated 2026-03-21 12:14:50 completed free_enrichment_v1 free_enrichment_script
5519 EJB Financial Services Pty Ltd 13 Butler St, Tully QLD 4854 13 Butler St Tully Tully QLD 4854.0 (01) 7406 8105 https://abr.business.gov ejbfinancialservicesptyltd@company.com.au 88 266 521 591 621774266 Accounting 90.0 Very High Moderate 2.0 4.5 True True So in summary, your business, EJB Financial Services, has solid foundations in local visibility and client trust. Your strong Google rating of 4.5 stars from reviews and high Business Details and Listings scores of 80 show you are found and valued locally. Your website performance is also reasonable at 70. However, a critical weakness is your severely outdated tech stack, scoring only 15, which likely means missing analytics and conversion tools. This is compounded by a low SEO score of 60 and an Online Reputation score of 68, indicating room to grow your review volume and authority. My top recommendation is to immediately audit and implement a modern tech foundation, starting with proper tracking and analytics, to convert your strong local visibility into measurable business growth and improved online competitive standing. generated_from_name generated_from_name generated 2026-03-21 12:14:50 completed free_enrichment_v1 free_enrichment_script
5520 Seriously Accountants 8 Mourilyan Rd, Innisfail QLD 4860 8 Mourilyan Rd Innisfail Innisfail QLD 4860.0 (07) 4061 1777 https://www.facebook.com/seriouslyaccountants/ contact@facebook.com 34 279 735 110 Accounting 42.0 Moderate Moderate 71.0 5.0 True True So in summary, your business, Seriously Accountants, has a strong foundation in local visibility and reputation. Your perfect 5-star Google rating from over 70 reviews is a major asset, demonstrating high client satisfaction. Furthermore, your business listings are complete and accurate, scoring 100, which ensures customers can reliably find your location and contact details. Your online reputation score of 80 supports this positive image. However, significant risks lie in your technical setup and digital marketing infrastructure. Your Tech Stack score is critically low at 15, indicating missing or broken tools for tracking website visitors and marketing performance. This makes measuring return on investment impossible. Additionally, your website performance and SEO scores need improvement to attract and convert more online searches into client leads. To address this, my top recommendation is to urgently audit and implement a proper analytics and tracking system, like Google Tag Manager, on your Facebook presence, then build a basic, fast-loading website to serve as your primary digital hub and conversion engine. website_domain generated 2026-03-21 12:14:51 completed free_enrichment_v1 free_enrichment_script
5521 Hurney Partners 6 Owen St, Innisfail QLD 4860 6 Owen St Innisfail Innisfail QLD 4860.0 (07) 4061 1085 https://hurneypartners.com.au enquiries@hurneypartners.com.au 50 814 684 759 556860897 Accounting 85.0 Very High Strong 1.0 5.0 True So in summary, Hurney Partners has a strong foundation in Innisfail's area with a 5-star rating and 1 reviews, indicating satisfied clients. The overall score of 71 reflects a well-rounded digital presence. The conversion rate is very high at 85, making this an excellent prospect. To improve, consider upgrading the tech stack, building more reviews. We could easily help you to improve this, let's talk about it. Hurney Partners is a professional accounting firm in Innisfail, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 5/5 with 1 reviews. Website available. Squarespace, GA generated 2026-03-21 12:14:51 completed free_enrichment_v1 free_enrichment_script
5522 Accountability Bas & Bookkeeping Services - Innisfail QLD and MYLOANS MY TAX 22 Ryan St, East Innisfail QLD 4860 22 Ryan St East Innisfail Innisfail QLD 4860.0 (01) 4880 5113 https://www.accountabilitybasandbookkeepingservicesinnisfailqldandmyloansmytax.com.au accountabilitybasandbookkeepingservicesinnisfailqldandmyloansmytax@company.com.au 0488 051 134 72 119 177 774 938238136 Accounting 42.0 Moderate Moderate 71.0 5.0 True True So in summary, your business has built a strong foundation of trust locally, as shown by your perfect 5 Google rating from over 70 reviews and a flawless 100 Listings Score. Your Business Details are also well-optimized at 90, ensuring good basic visibility for both your accounting and loan services. However, a significant weakness is your very low Tech Stack Score of 15, indicating critical gaps in website tracking and analytics tools. This makes measuring marketing performance and customer behavior nearly impossible. Combined with a moderate SEO Score of 60, your online presence lacks the technical infrastructure to convert visibility into measurable growth. My one clear recommendation is to immediately audit and implement core marketing technology, starting with proper tracking codes on your website to understand your audience and effectively measure your return on investment. generated_from_name generated_from_name generated 2026-03-21 12:14:51 completed free_enrichment_v1 free_enrichment_script
5523 Nickelle Vohs Professional Corporation 21 Tramway St, Innisfail QLD 4860 21 Tramway St Innisfail Innisfail QLD 4860.0 +1 403-227-6660 https://www.nickellevohspc.ca contact@nickellevohspc.ca 68 492 804 944 556879163 Accounting 84.0 Very High Strong 6.0 5.0 True So in summary, Nickelle Vohs Professional Corporation has a strong foundation in Innisfail's area with a 5-star rating and 6 reviews, indicating satisfied clients. However, there are key areas for improvement, particularly in tech stack (15), which are affecting the overall score of 69. The conversion rate is very high at 84, making this an excellent prospect. To improve, consider upgrading the tech stack, building more reviews. We could easily help you to improve this, let's talk about it. Nickelle Vohs Professional Corporation is a professional accounting firm in Innisfail, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 5/5 with 6 reviews. Website available. website_domain generated 2026-03-21 12:14:51 completed free_enrichment_v1 free_enrichment_script
5524 Halpin Partners 27 Owen St, Innisfail QLD 4860 27 Owen St Innisfail Innisfail QLD 4860.0 (07) 4030 2800 https://www.halpinpartners.com.au manager@halpinpartners.com.au 71 282 760 725 Accounting 90.0 Very High Strong 3.0 1.0 True So in summary, Halpin Partners has a presence in Innisfail's area with a 1-star rating and 3 reviews. However, there are key areas for improvement, particularly in online reputation (35), which are affecting the overall score of 68. The conversion rate is very high at 90, making this an excellent prospect. To improve, consider building more reviews. We could easily help you to improve this, let's talk about it. Halpin Partners is a professional accounting firm in Innisfail, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 1/5 with 3 reviews. Website available. WordPress, GTM, GA generated 2026-03-21 12:14:51 completed free_enrichment_v1 free_enrichment_script
5525 Findex Innisfail 88 Rankin St, Innisfail QLD 4860 88 Rankin St Innisfail Innisfail QLD 4860.0 (07) 4078 1700 https://www.findex.com.au/office/innisfail contact@findex.com.au 93 531 489 479 604676351 Accounting 61.0 Moderate Moderate 71.0 5.0 True So in summary, Findex Innisfail has a strong foundation in Innisfail's area with a 5-star rating and 71 reviews, indicating satisfied clients. The overall score of 79 reflects a well-rounded digital presence. With a conversion rate of 61, there is moderate opportunity. To improve, consider making contact info accessible. We could easily help you to improve this, let's talk about it. Findex Innisfail is a professional accounting firm in Innisfail, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 5/5 with 71 reviews. Website available. WordPress, GTM, GA website_domain generated 2026-03-21 12:14:51 completed free_enrichment_v1 free_enrichment_script
5526 Moore Stephens Queensland (Innisfail) 88 Rankin St, Innisfail QLD 4860 88 Rankin St Innisfail Innisfail QLD 4860.0 (01) 7407 8170 https://www.moorestephensqueenslandinnisfail.com.au moorestephensqueenslandinnisfail@company.com.au 58 392 583 557 Accounting 90.0 Very High Moderate 6.0 5.0 True So in summary, your business, Moore Stephens Queensland in Innisfail, has a strong foundational online presence in key areas. Your perfect 5-star Google rating from 6 reviews is a major asset for building trust, and your Listings Score of 100 shows excellent consistency across business directories. The solid Business Details score of 80 and a good Website Performance score of 70 indicate a reliable core profile. However, the data reveals critical weaknesses that hinder growth. Your Tech Stack Score is critically low at 15, meaning you likely lack essential tools for tracking visitor behavior and measuring marketing success. Furthermore, your SEO Score of 60 suggests your website is not fully optimized to be found by local clients searching for accounting services online. To address this, your one priority must be to implement and configure core website analytics, such as Google Analytics and Google Tag Manager. This single action will provide the data you need to understand your audience and make informed decisions to improve your SEO and conversion rates, turning visibility into measurable client growth. generated_from_name generated_from_name generated 2026-03-21 12:14:51 completed free_enrichment_v1 free_enrichment_script
5527 Cosca Innisfail 1 Ernest St, Innisfail QLD 4860 1 Ernest St Innisfail Innisfail QLD 4860.0 (07) 4077 9299 https://www.cosca.com.au info@cosca.com.au 25 905 140 932 Accounting 84.0 Very High Strong 6.0 5.0 True So in summary, Cosca Innisfail has a strong foundation in Innisfail's area with a 5-star rating and 6 reviews, indicating satisfied clients. The overall score of 81 reflects a well-rounded digital presence. The conversion rate is very high at 84, making this an excellent prospect. To improve, consider building more reviews. We could easily help you to improve this, let's talk about it. Cosca Innisfail is a professional accounting firm in Innisfail, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 5/5 with 6 reviews. Website available. WordPress, GTM, GA generated 2026-03-21 12:14:51 completed free_enrichment_v1 free_enrichment_script
5528 Cosca & Hogan Innisfail 1 Ernest St, Innisfail QLD 4860 1 Ernest St Innisfail Innisfail QLD 4860.0 (01) 7407 7929 https://cosca.com.au info@cosca.com.au 56 447 118 843 008602669 Accounting 61.0 Moderate Strong 71.0 5.0 True So in summary, Cosca & Hogan Innisfail has a strong foundation in Innisfail's area with a 5-star rating and 71 reviews, indicating satisfied clients. The overall score of 82 reflects a well-rounded digital presence. With a conversion rate of 61, there is moderate opportunity. We could easily help you to improve this, let's talk about it. Cosca & Hogan Innisfail is a professional accounting firm in Innisfail, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 5/5 with 71 reviews. Website available. WordPress, GTM, GA generated 2026-03-21 12:14:51 completed free_enrichment_v1 free_enrichment_script
5529 PnL Accounting Services 21 Tramway St, Innisfail QLD 4860 21 Tramway St Innisfail Innisfail QLD 4860.0 (07) 4223 0616 https://pnlas.com.au contact@pnlas.com.au 51 954 191 710 624390758 Accounting 84.0 Very High Moderate 6.0 5.0 True True So in summary, PnL Accounting Services has a strong foundation in Innisfail's area with a 5-star rating and 6 reviews, indicating satisfied clients. However, there are key areas for improvement, particularly in tech stack (15), which are affecting the overall score of 66. The conversion rate is very high at 84, making this an excellent prospect. To improve, consider upgrading the tech stack, building more reviews, making contact info accessible. We could easily help you to improve this, let's talk about it. PnL Accounting Services is a professional accounting firm in Innisfail, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 5/5 with 6 reviews. Website available. website_domain generated 2026-03-21 12:14:52 completed free_enrichment_v1 free_enrichment_script
5530 Cape 2 Coast Accounting & Bookkeeping Babinda, QLD 4861 Babinda Babinda Babinda QLD 4861.0 (01) 4020 4207 https://www.cape2coastaccountingandbookkeeping.com.au cape2coastaccountingandbookkeeping@company.com.au 99 498 780 421 316092293 Accounting 82.0 Very High Moderate 11.0 5.0 True True So in summary, your business, Cape 2 Coast Accounting Bookkeeping, demonstrates a strong foundation in local visibility and customer satisfaction. Your perfect 5-star Google rating from 11 reviews is a significant asset, and your Listings Score of 100 shows excellent local directory presence. Your Business Details are also robust at 80, aiding client discovery. Your online reputation score of 75 further supports this positive image. However, significant technical gaps are holding you back. Your Tech Stack Score is critically low at 15, indicating missing tools for tracking and conversion optimization. Your Website Performance, while adequate at 70, and SEO Score of 60 suggest the site itself is not fully optimized to attract and convert leads, especially without a clear tech foundation. To immediately address this, my top recommendation is to audit and implement a core marketing technology stack, starting with proper analytics and conversion tracking. This foundational step will unlock data to directly improve your website's performance and SEO, turning your strong local visibility into measurable growth. generated_from_name generated_from_name generated 2026-03-21 12:14:52 completed free_enrichment_v1 free_enrichment_script
5531 Edge Hill Accountancy 29 Norman St, Gordonvale QLD 4865 29 Norman St Gordonvale Gordonvale QLD 4865.0 (01) 7403 1337 https://www.edgehillaccountancy.com.au enquiries@edgehillaccountancy.com.au 58 228 840 427 Accounting 90.0 Very High Strong 3.0 5.0 True True So in summary, your business, Edge Hill Accountancy, has a solid foundation in key customer-facing areas. You have an excellent Google Rating of 5 stars and a strong Online Reputation score of 83, which builds immediate trust. Your Business Details are well-managed with a 90 score, and your Listings are performing well at 80, ensuring good local visibility for clients in Gordonvale. However, your primary weakness is a critically low Tech Stack score of 15, indicating missing tools for tracking marketing performance and user behavior. This makes measuring ROI and optimizing conversions nearly impossible. Furthermore, your Website Performance and SEO scores are only adequate, suggesting potential speed issues and missed opportunities to rank for key search terms. Our strongest recommendation is to immediately implement a robust analytics setup, like Google Tag Manager, to track website conversions and user journeys. This data is essential to inform all other marketing and website improvements, turning your good visibility into measurable growth. Edge Hill Accountancy is a professional accounting firm in Gordonvale, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:52 completed free_enrichment_v1 free_enrichment_script
5532 Top Tax Online 42 Riverstone Rd, Gordonvale QLD 4865 42 Riverstone Rd Gordonvale Gordonvale QLD 4865.0 (01) 7407 7621 https://toptaxonline.com.au tax@toptaxonline.com.au 20 297 243 584 656220593 Accounting 90.0 Very High Strong 4.0 3.8 True True So in summary, your business, Top Tax Online, has a solid foundation for local visibility. Your high Business Details Score of 90 and Listings Score of 80 mean your core contact information is accurate and widely listed online, which is excellent for local search. Your Google Rating of 3.8 stars from 4 reviews and a decent Online Reputation score of 66 show a base of client trust. However, your major weakness is a critically low Tech Stack Score of 15, which strongly suggests missing analytics and conversion tracking, leaving you blind to how visitors use your site. Combined with a moderate SEO Score of 60, this limits your ability to attract and convert potential clients effectively. Your website performance is also an area for improvement. My top recommendation is to immediately implement a proper analytics setup, like Google Tag Manager, to track website interactions and identify conversion bottlenecks. This data is essential to inform all other marketing and website improvements for growth. Top Tax Online is a professional accounting firm in Gordonvale, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:52 completed free_enrichment_v1 free_enrichment_script
5533 Hall Scott & Associates Gordonvale, QLD 4865 Gordonvale Gordonvale Gordonvale QLD 4865.0 (01) 7405 6639 https://www.hallscottandassociates.com.au hallscottandassociates@company.com.au 55 691 304 542 Accounting 90.0 Very High Moderate 3.0 5.0 True So in summary, your business, Hall Scott Associates, has established a solid foundation for local trust and visibility. Your perfect 5 Google rating from 3 reviews is a significant strength, directly supporting your B2C focus. Furthermore, your Business Details and Listings scores of 70 and 65 respectively indicate a reasonably consistent and accurate online presence, which is crucial for an accounting firm in Gordonvale. Your Website Performance and SEO scores are also at a functional baseline. However, the data reveals critical operational weaknesses. Your Tech Stack score is critically low at 15, meaning you likely lack essential tracking and analytics tools to understand client behaviour. This gap prevents you from measuring marketing effectiveness and optimizing for conversions. Combined with an overall score of 57, it shows your online presence isn't fully supporting business growth. To address this, you must immediately implement a core analytics platform like Google Analytics 4. This single action will provide the data needed to make informed decisions, track how clients find you, and systematically improve your website's ability to generate leads. generated_from_name generated_from_name generated 2026-03-21 12:14:52 completed free_enrichment_v1 free_enrichment_script
5534 VA Tax Accountants 3/106 Barnard Dr, Mount Sheridan QLD 4868 3/106 Barnard Dr Mount Sheridan Cairns QLD 4868.0 999999977 https://www.vataxaccountants.com contact@vataxaccountants.com 83 807 721 247 323064478 Accounting 85.0 Very High Strong 1.0 5.0 True True So in summary, VA Tax Accountants has a strong foundation in Mount Sheridan's area with a 5-star rating and 1 reviews, indicating satisfied clients. The overall score of 66 reflects a well-rounded digital presence. The conversion rate is very high at 85, making this an excellent prospect. To improve, consider upgrading the tech stack, building more reviews. We could easily help you to improve this, let's talk about it. VA Tax Accountants is a professional accounting firm in Mount Sheridan, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 5/5 with 1 reviews. Website available. Wix, GA website_domain generated 2026-03-21 12:14:52 completed free_enrichment_v1 free_enrichment_script
5535 SiDCOR Chartered Accountants - Cairns 1/588 Mulgrave Rd, Woree QLD 4868 1/588 Mulgrave Rd Woree Woree QLD 4868.0 (01) 7403 3840 https://sidcor.com.au contact@sidcor.com.au 95 562 753 888 392458398 Accounting 90.0 Very High Moderate 1.0 3.8 True True So in summary, your business has a solid foundation online. Your Business Details and Listings scores of 80 show good visibility in local directories, and your Website Performance and SEO at 70 indicate a functional, reasonably optimized site. This provides a reliable base for clients in Cairns to find your tax and advisory services. However, a significant critique is the major gap in your tech stack, scoring only 45, which likely means missing crucial tracking and analytics for understanding client behaviour. Combined with a modest Google Rating of 3.8 from just one review, your online reputation lacks social proof and you're operating without key conversion data. My core advice is to immediately implement a structured review generation campaign with existing clients to build your rating, while simultaneously auditing and installing proper conversion tracking, like Google Tag Manager, to measure what truly drives enquiries. This dual action will directly address your highest risks and unlock growth. SiDCOR Chartered Accountants - Cairns is a professional accounting firm in Woree, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. WordPress, GA website_domain generated 2026-03-21 12:14:52 completed free_enrichment_v1 free_enrichment_script
5536 Super Accounting with Nyssa Gower Suite 2A/566 Mulgrave Rd, Woree QLD 4868 Suite 2A/566 Mulgrave Rd Woree Edmonton QLD QLD 4868.0 (01) 7402 1280 https://www.superaccountingcairns.com.au contact@superaccountingcairns.com.au 31 915 781 836 Accounting 90.0 Very High Strong 20.0 3.8 True True So in summary, your business, Super Accounting with Nyssa Gower, has established a solid foundational online presence. Your business details are excellent with a 90 score, and your listings are perfect at 100, ensuring you are easy to find locally. With a Google Rating of 3.8 from 20 reviews, you have a credible base of client feedback and a decent online reputation score of 71. Your website is performing adequately at 70 and has a functional SEO foundation at 60. However, the data reveals two critical weaknesses. First, your tech stack score is critically low at 15, indicating a severe lack of essential marketing and analytics tools, which means you cannot track performance or understand your clients. Second, while your SEO is functional, it has significant room for improvement to drive more targeted traffic, and your review volume is low for competitive visibility. My top recommendation is to immediately implement a core tech stack, starting with Google Analytics and Google Tag Manager, to track website visitors and conversions. This single action will provide the data needed to systematically improve your marketing, refine your SEO, and launch a proactive review generation campaign to build social proof. Super Accounting with Nyssa Gower is a professional accounting firm in Woree, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. website_domain generated 2026-03-21 12:14:52 completed free_enrichment_v1 free_enrichment_script
5537 Adcock Accounting Pty Ltd 21 Claridge Cl, Mount Sheridan QLD 4868 21 Claridge Cl Mount Sheridan Edmonton QLD QLD 4868.0 (01) 4093 6360 https://adcockaccounting.com.au anthony@adcockaccounting.com.au +61409363605 34 716 243 591 963318390 Accounting 90.0 Very High Strong 13.0 4.7 True True So in summary, your business has a strong foundation with excellent local visibility. Your Google My Business listing is perfectly optimized with a 100 score, and you benefit from a high 4.7-star rating which builds great trust with both local individuals and other businesses. Your business details are also well-maintained at 90, ensuring clients can easily find and contact you. The primary weakness is your very low Tech Stack score of 15, indicating a lack of essential marketing and analytics tools on your website. This gap makes it impossible to track how visitors find you or what they do on your site, crippling your ability to convert interest into leads. Furthermore, your website performance and SEO are only adequate, suggesting missed opportunities for better search visibility and user experience. My one clear recommendation is to immediately implement a robust analytics and conversion toolkit, starting with Google Tag Manager. This single action will unlock the data you need to understand your audience and systematically improve your website's performance and marketing return on investment. Adcock Accounting Pty Ltd is a professional accounting firm in Mount Sheridan, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:52 completed free_enrichment_v1 free_enrichment_script
5538 Caligaris Accounting Woree, QLD 4868 Woree Woree Woree QLD 4868.0 (01) 7405 4407 https://www.caligaris.com.au/ contact@caligaris.com.au 14 546 881 158 Accounting 90.0 Very High Moderate 5.0 5.0 True True So in summary, your business has a strong foundation in client trust and local visibility, evidenced by a perfect 5-star Google rating and a solid 75 score for Online Reputation. Your Business Details and Listings are reasonably well-maintained at 70 and 65 respectively, aiding local discovery, and your Website Performance is a relative strength at 70. However, a critical weakness is your severely underdeveloped Tech Stack, scoring only 15, which indicates missing analytics, tracking, and likely conversion tools. This gap makes it impossible to measure marketing ROI or understand client behavior, while your SEO Score of 60 also leaves room for improvement to attract more organic traffic. My top recommendation is to immediately implement and configure core analytics and conversion tools like Google Tag Manager and a CRM system; this single action will unlock data-driven insights, allowing you to optimize your website and marketing spend effectively. website_domain generated 2026-03-21 12:14:52 completed free_enrichment_v1 free_enrichment_script
5539 Erick's Accounting Woree, QLD 4868 Woree Woree Woree QLD 4868.0 (01) 4781 8271 https://www.ericksaccounting.com.au ericksaccounting@company.com.au +61478182716 41 798 954 267 Accounting 90.0 Very High Moderate 1.0 5.0 True True So in summary, your business, Erick's Accounting, has established a solid foundation for trust and local visibility. Your perfect 5-star Google rating is a powerful asset, and your business details and listings are reasonably complete at 70 and 65, aiding local discovery. Your website performance and SEO scores are also at a competent baseline for generating visibility. However, a critical weakness is your severely underdeveloped tech stack, scoring only 15. This major gap likely means you lack fundamental tools for tracking conversions, analysing visitor behaviour, and automating marketing, making it impossible to measure what drives real business growth. Your online presence is thus a passive brochure rather than an active client acquisition tool. My single, clear recommendation is to immediately implement core analytics and conversion tracking, starting with Google Analytics 4 and a call-tracking solution. This will transform your website from a static listing into a measurable growth engine, allowing you to see which services attract clients and optimise your marketing spend effectively. generated_from_name generated_from_name generated 2026-03-21 12:14:53 completed free_enrichment_v1 free_enrichment_script
5540 Active Accountants Cairns Woree, QLD 4868 Woree Woree Woree QLD 4868.0 (01) 7422 2165 https://www.activeaccountants.au/ contact@activeaccountants.au 87 893 648 273 808563270 Accounting 90.0 Very High Moderate 8.0 5.0 True True So in summary, your business, Active Accountants Cairns, has a solid foundation for local visibility. Your Google My Business listing is a major strength, with a perfect 5-star rating from 8 reviews and a high Listings Score of 85, making you easy to find for local searches. Your website performance and online reputation scores are also above average, indicating a decent user experience and positive client sentiment. However, the data reveals a critical vulnerability in your Tech Stack, scoring only 15. This severely limits your ability to track visitor behaviour, measure marketing ROI, and understand what drives leads or conversions. Your SEO score of 60 also suggests significant room for improvement in how your website content ranks for relevant search terms. To address this core weakness, you should immediately implement and configure a robust analytics and conversion tracking system, such as Google Tag Manager, on your website to start collecting actionable data on your visitors. website_domain generated 2026-03-21 12:14:53 completed free_enrichment_v1 free_enrichment_script
5541 G. W. & Co CPA Woree, QLD 4868 Woree Woree Woree QLD 4868.0 (01) 7403 1723 https://www.gwandcocpa.com.au gwandcocpa@company.com.au 29 579 515 609 Accounting 90.0 Very High Moderate 66.0 3.7 True True So in summary, your business, G. W. Co CPA, has established a solid foundation in local online visibility. Your strong Listings Score of 85 indicates your core business details are well-distributed across key directories, which is crucial for local search. Furthermore, you have a respectable volume of reviews and a Google Rating of 3.7 stars, providing social proof to both your B2B and B2C clients. Your Website Performance score of 70 is also a positive baseline. However, the data reveals critical weaknesses that hinder growth and conversion. Your Tech Stack Score is severely low at 15, strongly suggesting a lack of essential tracking and analytics tools, meaning you are likely flying blind on how visitors use your site. Combined with a middling SEO Score of 60, your online presence lacks the technical sophistication to effectively attract and convert high-value clients. My primary recommendation is to immediately implement a robust analytics and tracking setup, such as Google Tag Manager, to diagnose user behavior and website performance. This single action will provide the data needed to systematically fix SEO, improve user experience, and convert your existing visibility into measurable client leads. generated_from_name generated_from_name generated 2026-03-21 12:14:53 completed free_enrichment_v1 free_enrichment_script
5542 John Woodward Accounting Pty Ltd Woree, QLD 4868 Woree Woree Woree QLD 4868.0 (01) 7403 3166 https://www.jwaccountants.com.au/ contact@jwaccountants.com.au 41 423 350 294 Accounting 90.0 Very High Moderate 52.0 3.8 True True So in summary, your business, John Woodward Accounting, has established a solid operational foundation in Woree. Your listings are managed well with an 85 score, ensuring good local visibility. You also have a decent number of Google reviews, and your website performance and basic business details are reasonably strong at 70. This indicates a functional online presence for both your B2B and B2C clients. However, the data reveals critical weaknesses that are likely hindering growth. Your tech stack score is extremely low at 15, suggesting missing analytics and tracking tools, which means you're operating blindly online. Furthermore, your SEO score of 60 and online reputation score of 63 show significant room for improvement in how you are found and perceived by potential clients searching for accountants. My primary recommendation is to immediately implement a robust analytics and conversion tracking system, such as Google Tag Manager, on your website. This single action will provide the data you need to understand client behaviour, measure marketing effectiveness, and make informed decisions to systematically improve your SEO and reputation management. website_domain generated 2026-03-21 12:14:53 completed free_enrichment_v1 free_enrichment_script
5543 Barbagallo Linda & Associates Woree, QLD 4868 Woree Woree Woree QLD 4868.0 (01) 7403 3114 https://www.lbapartners.com.au/ contact@lbapartners.com.au 55 677 631 821 Accounting 90.0 Very High Moderate 5.0 3.8 True So in summary, your business, Barbagallo Linda Associates, has established a credible foundation for a local accounting firm in Woree. Your Google Business Profile is reasonably complete with a 70 score, and your website performance is solid at 70. You have a decent Google rating of 3.8 stars from 5 reviews, indicating client satisfaction, and your SEO score of 60 suggests some basic visibility is in place. However, a significant critique is your very low Tech Stack score of 15, which strongly indicates missing essential marketing and analytics tools like Google Tag Manager or conversion tracking. This makes it impossible to measure how visitors interact with your site or where your clients originate. Furthermore, your online reputation score of 58 suggests room to grow and actively manage your reviews. My clear advice is to immediately implement a core analytics and tracking setup on your website. This single action will unlock the data you need to understand your audience and make informed marketing decisions, transforming your online presence from a static brochure into a measurable growth engine. website_domain generated 2026-03-21 12:14:53 completed free_enrichment_v1 free_enrichment_script
5544 H&R Block Tax Accountants - Cairns Woree, QLD 4868 Woree Woree Woree QLD 4868.0 (01) 7405 1631 https://www.hrblock.com.au/locator/qld/cairns contact@hrblock.com.au 87 530 979 807 Accounting 90.0 Very High Moderate 4.0 3.8 True True So in summary, your business has established a solid foundation for local visibility in Cairns. Your Google My Business listing is performing relatively well with a score of 65, and your website has a decent performance score of 70, which helps in attracting potential clients. The Google rating of 3.8 stars from 4 reviews indicates a generally positive, if not outstanding, customer reception for both your B2B and B2C services. However, there are critical areas dragging down your overall online effectiveness. Your tech stack score is alarmingly low at 15, suggesting missing or broken tracking tools like Google Analytics or Tag Manager, which means you are flying blind on visitor behavior. Furthermore, your online reputation score of 58 and SEO score of 60 indicate significant room for improvement in managing reviews and optimizing your content to rank higher in search results. My primary recommendation is to immediately audit and fix your website's technical tracking infrastructure. Installing and verifying proper tracking will provide the data you need to understand your customers, measure marketing ROI, and systematically address your SEO and reputation gaps. website_domain generated 2026-03-21 12:14:53 completed free_enrichment_v1 free_enrichment_script
5545 Income Tax Specialists Woree, QLD 4868 Woree Woree Woree QLD 4868.0 (01) 7305 3342 https://www.q-tax.com.au/ contact@q-tax.com.au 86 243 508 895 775300924 Accounting 90.0 Very High Moderate 8.0 4.5 True True So in summary, your business, Income Tax Specialists, has a solid foundation for local visibility. Your strong 4.5-star Google rating from 8 reviews builds excellent trust with potential clients in Woree. Furthermore, your business listings are in good health with an 85 score, ensuring people can find your contact details, and your website performance is acceptable at 70. However, a critical weakness is your very low Tech Stack score of 15, which likely means you are missing essential tools like Google Analytics or Tag Manager to track website visitors and conversions. This makes measuring marketing ROI impossible. Your SEO score of 60 also indicates room for improvement in how you attract organic search traffic. My direct advice is to immediately implement and configure a proper analytics and conversion tracking system on your website; this single action will reveal where your online enquiries come from and allow you to strategically invest in marketing that delivers measurable client growth. website_domain generated 2026-03-21 12:14:53 completed free_enrichment_v1 free_enrichment_script
5546 Adaptive Bookkeeping & Taxation 27 Caesar St, Bentley Park QLD 4869 27 Caesar St Bentley Park Bentley Park QLD 4869.0 (01) 4487 1800 https://www.adaptivebookkeepingandtaxation.com.au adaptivebookkeepingandtaxation@company.com.au +61448718002 29 459 384 155 441099649 Accounting 90.0 Very High Moderate 1.0 5.0 True True So in summary, your business, Adaptive Bookkeeping Taxation, has a solid foundation in local visibility and client trust. Your Google My Business listing is strong with a perfect 5-star rating, and your Business Details and Listings scores are high at 80, indicating good local SEO and accurate information. Your website performance is also reasonably good at 70. These are significant strengths for attracting both local individuals and businesses. However, your major weakness is a critically low Tech Stack score of 15. This suggests your website likely lacks essential marketing and analytics tools, such as proper tracking with Google Tag Manager or conversion pixels. This makes measuring marketing ROI and understanding visitor behavior nearly impossible. Furthermore, your SEO score of 60 indicates room for improvement in content and technical SEO to attract more organic search traffic. My single, most impactful recommendation is to immediately audit and implement a core marketing technology stack on your website, starting with proper analytics and conversion tracking, to transform your good visibility into measurable growth. generated_from_name generated_from_name generated 2026-03-21 12:14:53 completed free_enrichment_v1 free_enrichment_script
5547 Redi Tax Shop 3, Piccone Village, 113 Bruce Hwy, Edmonton QLD 4869 Shop 3, Piccone Village, 113 Bruce Hwy Edmonton Edmonton QLD QLD 4869.0 (01) 7405 7683 https://facebook.com/reditax/cpa contact@facebook.com 47 584 328 297 Accounting 90.0 Very High Moderate 1.0 1.0 True True So in summary, your business, Redi Tax, demonstrates a solid foundation in core business details and local listings, both scoring a strong 80. Your website performance is also reasonably effective at 70, and your SEO fundamentals are acceptable at 60. This indicates good basic visibility and operational information for potential clients in Edmonton, QLD. Your challenge is severe. Your online reputation is a critical risk with a Google Rating of 1 stars from only one review, scoring just 35. Furthermore, your tech stack is severely underdeveloped at 15, likely meaning you lack essential tools for tracking marketing performance and client interactions on your Facebook-based website. This gap prevents you from understanding client behavior and improving conversions. Therefore, my one clear recommendation is to immediately implement a professional review generation strategy with existing satisfied clients to build a positive public reputation, while simultaneously auditing and installing basic web analytics to track how visitors use your Facebook page. website_domain generated 2026-03-21 12:14:53 completed free_enrichment_v1 free_enrichment_script
5548 Accountants at Latitude 17 199 Bruce Hwy, Edmonton QLD 4869 199 Bruce Hwy Edmonton Edmonton QLD QLD 4869.0 (01) 7404 5239 https://www.accountantsatlatitude17.com.au accountantsatlatitude17@company.com.au 98 479 439 825 Accounting 90.0 Very High Moderate 9.0 3.8 True True So in summary, your business, Accountants at Latitude 17, has a strong foundational presence in Edmonton, QLD. Your business details are complete with an 80 score, and your local listings are perfectly managed at 100, ensuring you are easy for local clients to find. With a Google Rating of 3.8 stars from 9 reviews, you have a base of positive client feedback to build upon. However, the data reveals critical gaps. Your Tech Stack score is severely low at 15, indicating you likely lack essential tools like analytics or conversion tracking, making marketing performance invisible. Your website's SEO is only at 60, and your online reputation score of 58 suggests your review volume and management need immediate attention to remain competitive. To address this, my primary recommendation is to urgently implement and configure a core analytics platform, such as Google Tag Manager, on your website to start measuring visitor behaviour and conversion actions, which will unlock your ability to make data-driven marketing and website improvements. generated_from_name generated_from_name generated 2026-03-21 12:14:54 completed free_enrichment_v1 free_enrichment_script
5549 Complete Business Advisors 193 Bruce Hwy, Edmonton QLD 4869 193 Bruce Hwy Edmonton Edmonton QLD QLD 4869.0 (01) 7404 5155 https://www.completebusinessadvisors.com.au completebusinessadvisors@company.com.au 12 987 726 326 Accounting 90.0 Very High Moderate 2.0 3.8 True So in summary, your business, Complete Business Advisors, has established a solid foundation in key operational areas. Your Business Details and Listings Scores of 80 indicate strong local visibility and accurate core information for clients in Edmonton QLD. Furthermore, your Website Performance is adequate at 70, and your SEO has a reasonable baseline score of 60. However, significant weaknesses are creating risk and limiting growth. Your Tech Stack Score is critically low at 15, meaning you likely lack essential tools for tracking marketing performance and customer behavior. This is compounded by a middling Online Reputation score of 58 and a Google Rating of just 3.8 stars from only 2 reviews, which fails to build trust with potential clients searching for a reliable accounting advisor. To address this, you must immediately implement a review generation campaign, asking satisfied clients for Google reviews, while installing a proper analytics and tag management system to measure what drives enquiries and conversions. generated_from_name generated_from_name generated 2026-03-21 12:14:54 completed free_enrichment_v1 free_enrichment_script
5550 Australia Post - Bentley Park CPA Shop 2/96 McLaughlin Rd, Bentley Park QLD 4869 Shop 2/96 McLaughlin Rd Bentley Park Bentley Park QLD 4869.0 +61 131318 https://auspost.com.au/locate/showpop/426896 contact@auspost.com.au 26 131 847 414 Accounting 90.0 Very High Moderate 4.0 3.8 True True So in summary, your business has a solid foundation for local visibility and credibility. Your Business Details and Listings Scores are strong at 80, ensuring you are found in local searches, and your Google Rating of 3.8 stars from 4 reviews provides a base of social proof. Your website performance is also reasonably good at 70. However, a major weakness is your extremely low Tech Stack Score of 15, indicating critical gaps in tools for tracking visitor behaviour and measuring marketing ROI. Your SEO is only adequate at 60, limiting organic reach, and the Online Reputation score of 58 suggests room to actively manage and grow your reviews. Therefore, my primary recommendation is to immediately implement and configure core analytics and conversion tracking, like Google Tag Manager, on your website to understand your customer journey and make data-driven marketing decisions. Australia Post - Bentley Park CPA is a professional accounting firm in Bentley Park, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. website_domain generated 2026-03-21 12:14:54 completed free_enrichment_v1 free_enrichment_script
5551 Kevin Morellini Bookkeeping 10 Tuppy Pl, Edmonton QLD 4869 10 Tuppy Pl Edmonton Edmonton QLD QLD 4869.0 (01) 4167 0341 https://www.kevinmorellinibookkeeping.com.au kevinmorellinibookkeeping@company.com.au +61416703414 92 668 526 902 430015825 Accounting 90.0 Very High Moderate 1.0 3.8 True True So in summary, your business, Kevin Morellini Bookkeeping, has established a solid foundational presence with strong business details and listings accuracy, both scoring 80. Your website performance is also reasonably effective at 70, and you maintain a decent SEO score of 60, indicating some visibility for local searches in Edmonton QLD. You serve both individual and business clients effectively. However, the data reveals critical weaknesses. Your tech stack score is critically low at 15, meaning you likely lack essential tracking and conversion tools, making marketing performance a mystery. Furthermore, your online reputation is a risk with a 3.8-star Google rating based on only 1 reviews, which undermines trust, and your overall online presence score of 58 shows significant room for improvement. My primary advice is to immediately implement a basic analytics and conversion tracking setup, like Google Tag Manager, to measure website interactions, and then proactively launch a simple client review generation campaign to build social proof and directly address your reputation score. This one-two punch of gaining data and building trust is the most actionable step to start converting your existing visibility into more reliable client growth. generated_from_name generated_from_name generated 2026-03-21 12:14:54 completed free_enrichment_v1 free_enrichment_script
5552 Tropic Coast Bookkeeping 24 Allinga Cl, Bentley Park QLD 4869 24 Allinga Cl Bentley Park Bentley Park QLD 4869.0 (01) 4060 5064 https://www.tropiccoastbookkeeping.com.au rachelle@tropiccoastbookkeeping.com.au +61406050644 20 441 397 303 804003827 Accounting 90.0 Very High Strong 1.0 3.8 True True So in summary, your business, Tropic Coast Bookkeeping, has a solid foundation for local visibility. Your Business Details score is excellent at 90, and your Listings score is strong at 80, meaning your core contact information is accurately published online. Your website is operational with a reasonable performance score of 70, and you maintain a Google Rating of 3.8 stars, which provides a base level of social proof for both your B2B and B2C clients. However, a major critique is your severely underdeveloped technology stack, scoring only 15. This indicates a lack of essential marketing and analytics tools, such as proper conversion tracking, which makes measuring your online ROI nearly impossible. Additionally, your SEO score of 60 and Online Reputation score of 66 reveal significant room for improvement in how you are found and perceived online. My primary advice is to immediately implement a foundational tech stack, starting with Google Tag Manager and analytics, to track website conversions and user behaviour. This single actionable step will provide the crucial data needed to systematically improve your SEO, website performance, and ultimately, your client acquisition. Tropic Coast Bookkeeping is a professional accounting firm in Bentley Park, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:54 completed free_enrichment_v1 free_enrichment_script
5553 Trinity Advisory – Tax, Accounting, and Coaching for Tradie Businesses Bentley Park, QLD 4869 Bentley Park Bentley Park Bentley Park QLD 4869.0 (01) 7539 1474 https://www.trinityadvisory.com.au/ contact@trinityadvisory.com.au 50 964 838 237 Accounting 42.0 Moderate Moderate 119.0 5.0 True True So in summary, your business, Trinity Advisory, has a strong foundation in client trust and local visibility. Your exceptional 5-star Google rating from 119 reviews is a major asset, and your business listings are well-managed with an 85 score, ensuring clients in Bentley Park can find you. Your website performance and basic SEO are at a decent starting point. However, your primary weakness is a critical lack of modern marketing technology, shown by a very low 15 Tech Stack Score. This suggests you are likely missing essential tools for tracking website conversions, understanding client behaviour, and running targeted digital campaigns. This gap severely limits your ability to measure marketing return and attract new clients efficiently. Our one clear recommendation is to immediately audit and implement a core marketing tech stack, starting with proper analytics and conversion tracking on your website. This foundational fix will unlock data to drive all future growth for your tradie accounting and coaching services. website_domain generated 2026-03-21 12:14:54 completed free_enrichment_v1 free_enrichment_script
5554 Wedrat Chartered Accountants Bentley Park, QLD 4869 Bentley Park Bentley Park Bentley Park QLD 4869.0 (01) 7403 2187 https://www.wedratca.com.au/?utm_source=google&utm_medium=organic&utm_campaign=gmb contact@wedratca.com.au 21 659 119 127 122928877 Accounting 90.0 Very High Moderate 10.0 3.8 True True So in summary, your business, Wedrat Chartered Accountants, has established a solid foundation for local visibility. Your Google Business Profile listing is strong at 85, which helps clients in Bentley Park find you, and the 3.8-star rating from 10 reviews provides a base of social proof. Your website performance and business details are also reasonably sound at 70. However, significant weaknesses are holding you back. Your tech stack score is critically low at 15, indicating missing or broken tools for tracking conversions and user behaviour, which makes marketing ROI impossible to measure. Furthermore, your SEO score of 60 and online reputation score of 58 suggest your website isn't fully optimised to attract search traffic and you have limited review volume to build trust. My primary advice is to immediately audit and implement core tracking technologies, like Google Tag Manager and Analytics, to understand how clients find and use your site; this data is essential to fix other issues and drive growth. website_domain generated 2026-03-21 12:14:54 completed free_enrichment_v1 free_enrichment_script
5555 Sierra Accounting & Consulting Pty Ltd Bentley Park, QLD 4869 Bentley Park Bentley Park Bentley Park QLD 4869.0 (01) 7404 1777 https://sierraconsulting.com.au/ contact@sierraconsulting.com.au 10 446 270 127 709581184 Accounting 90.0 Very High Moderate 73.0 3.8 True True So in summary, your business, Sierra Accounting Consulting, has a solid foundation with a good local presence. Your strong Listings Score of 85 indicates your business details are well-distributed online, aiding visibility. You also have a decent volume of reviews and a reasonable Google Rating of 3.8 stars, which builds initial trust with both your B2B and B2C clients. Your website performance and basic SEO are at acceptable levels. However, a critical weakness is your extremely low Tech Stack Score of 15, which suggests missing or broken tracking tools like Google Analytics. This leaves you blind to how visitors use your site and where leads are lost. Furthermore, your Online Reputation score of 63 shows room to improve client feedback and your Overall Score of 58 indicates significant digital marketing gaps. Your single most important action is to immediately audit and correctly install essential tracking, such as Google Tag Manager and conversion pixels. This will provide the data needed to systematically improve every other aspect of your marketing and sales funnel. website_domain generated 2026-03-21 12:14:54 completed free_enrichment_v1 free_enrichment_script
5556 Tax Masters Accounting Bentley Park, QLD 4869 Bentley Park Bentley Park Bentley Park QLD 4869.0 (01) 7552 0239 https://www.goldcoastaccountant.net.au/ contact@goldcoastaccountant.net.au 60 501 877 579 225669791 Accounting 90.0 Very High Moderate 23.0 4.5 True True So in summary, your business, Tax Masters Accounting, has established a solid foundation in several key areas. Your high Google Rating of 4.5 stars from 23 reviews and a strong Listings Score of 85 indicate good local visibility and a positive reputation that attracts both individuals and businesses. Your Website Performance and Business Details scores are also respectable, suggesting your core online information is present and functional. However, the data reveals a critical vulnerability. Your Tech Stack Score is severely low at 15, which typically means your website lacks essential marketing and analytics tools. This gap makes it difficult to track visitor behavior, measure campaign effectiveness, and likely hinders your ability to convert site visits into client inquiries. Your SEO Score of 60 also indicates room for improvement in attracting organic search traffic. My primary recommendation is to immediately audit and implement a proper marketing technology stack, starting with tools like Google Analytics 4 and Google Tag Manager to track conversions. This single action will provide the data needed to systematically improve your website's performance and marketing return on investment. website_domain generated 2026-03-21 12:14:54 completed free_enrichment_v1 free_enrichment_script
5557 Fluid Business Advisory Bentley Park, QLD 4869 Bentley Park Bentley Park Bentley Park QLD 4869.0 (01) 7404 1258 https://www.fluidadvisory.com.au/?utm_source=google&utm_medium=organic&utm_campaign=gmb contact@fluidadvisory.com.au 60 491 741 591 939620286 Accounting 47.0 Moderate Moderate 43.0 4.9 True So in summary, your business, Fluid Business Advisory, has built a very strong foundation for local visibility and trust. Your excellent 4.9-star Google rating from 43 reviews and a high 85 Listings Score show you are well-presented and credible in your Bentley Park community. Your website performance is also solid at 70, contributing to a decent online presence. However, the data reveals critical weaknesses that hinder growth and client conversion. Your Tech Stack Score is critically low at 15, strongly indicating missing or broken tracking tools like Google Analytics or Tag Manager. This means you cannot measure what marketing works. Furthermore, your SEO Score of 60 shows untapped potential to attract more organic search traffic. Your single most urgent priority is to install and verify proper conversion tracking on your website. This one action will unlock the data you need to make informed decisions, measure return on investment, and systematically improve all other marketing efforts. website_domain generated 2026-03-21 12:14:54 completed free_enrichment_v1 free_enrichment_script
5558 BC Accountants Australia Pty Ltd Bentley Park, QLD 4869 Bentley Park Bentley Park Bentley Park QLD 4869.0 999999977 https://www.bcaccountants.com.au/ contact@bcaccountants.com.au 51 852 360 350 Accounting 82.0 Very High Moderate 15.0 5.0 True True So in summary, your business has a strong foundation for local visibility and trust. Your excellent Google rating of 5 stars from 15 reviews is a major asset, and your Listings Score of 85 shows your core business information is well-distributed online. Your website performance and business details are also at a solid baseline. The critique is that your technological foundation is critically weak, with a Tech Stack Score of only 15. This severe gap means you likely lack essential tools for tracking conversions, understanding visitor behaviour, and running effective digital campaigns. Furthermore, your SEO score of 60 indicates missed opportunities to attract more organic search traffic. Your single most impactful action is to implement a proper analytics and tracking infrastructure, such as Google Tag Manager. This will immediately reveal how clients find and use your site, allowing you to make data-driven decisions to improve marketing ROI and grow your practice. website_domain generated 2026-03-21 12:14:55 completed free_enrichment_v1 free_enrichment_script
5559 Gary Wilkins & Associates Bentley Park, QLD 4869 Bentley Park Bentley Park Bentley Park QLD 4869.0 (01) 7403 3191 https://wilkinscpa.com.au/ contact@wilkinscpa.com.au 79 911 767 663 Accounting 90.0 Very High Moderate 12.0 4.7 True So in summary, your business has a solid foundation for local visibility and trust. Your high Google rating of 4.7 stars from 12 reviews is a major asset, and your Listings Score of 85 indicates good local directory presence. Your Website Performance and Business Details scores are also reasonably strong at 70, suggesting your core online information is largely in order. However, the data reveals a critical technical weakness with a Tech Stack Score of only 15. This severely limits your ability to track visitor behaviour, measure marketing effectiveness, and understand what drives leads. Your SEO Score of 60 also indicates room for improvement in how you are found for key accounting search terms in Bentley Park. My top recommendation is to immediately audit and implement proper website analytics and tracking tools; this single action will provide the data needed to systematically improve your SEO, conversion rates, and overall marketing strategy. website_domain generated 2026-03-21 12:14:55 completed free_enrichment_v1 free_enrichment_script
5560 Cairns Quality Accounting Bentley Park, QLD 4869 Bentley Park Bentley Park Bentley Park QLD 4869.0 (01) 7403 1804 https://www.cairnsqualityaccounting.com.au/?utm_source=google&utm_medium=organic&utm_campaign=gmb contact@cairnsqualityaccounting.com.au 12 438 121 766 266175539 Accounting 62.0 More Likely Moderate 34.0 4.8 True True So in summary, your business, Cairns Quality Accounting, has a very strong foundation in local visibility and trust. Your excellent 4.8-star Google rating from 34 reviews and high 85 Listings Score show you are found and respected by your community. Your Website Performance and Business Details are also solid, indicating a functional site and good core information. However, your major weakness is a critically low Tech Stack score of 15, which means you are likely missing essential tracking and conversion tools on your website. This gap makes it impossible to measure what marketing works or understand client behavior. Your SEO is also just adequate, limiting your reach to new clients searching online. My one clear recommendation is to immediately implement proper website analytics, like Google Tag Manager, to track conversions and user journeys; this data is essential to strategically invest in and improve your SEO and marketing efforts for measurable growth. website_domain generated 2026-03-21 12:14:55 completed free_enrichment_v1 free_enrichment_script
5561 Advantage Accountancy Bentley Park, QLD 4869 Bentley Park Bentley Park Bentley Park QLD 4869.0 (01) 7404 1677 https://www.advantageaccountancy.com.au/ contact@advantageaccountancy.com.au 87 952 916 673 617818756 Accounting 90.0 Very High Moderate 66.0 3.7 True True So in summary, your business, Advantage Accountancy, has established a solid local foundation. Your strong Listings Score of 85 indicates good visibility in local directories, which is crucial for attracting both your B2B and B2C clients in Bentley Park. Furthermore, your website performance is reasonable at 70, and you maintain a Google Rating of 3.7 stars with over 60 reviews, providing a base of social proof. However, significant weaknesses are holding you back. Your Tech Stack Score is critically low at 15, meaning you likely lack essential tools for tracking conversions, analysing visitor behaviour, and running effective digital campaigns. This gap makes marketing investment difficult to measure. Additionally, your SEO Score of 60 and Online Reputation score of 61 indicate missed opportunities to rank higher in search results and proactively manage your client feedback. My foremost recommendation is to immediately audit and implement a core marketing technology stack, starting with proper analytics and conversion tracking on your website, to transform your online visibility into measurable client growth. website_domain generated 2026-03-21 12:14:55 completed free_enrichment_v1 free_enrichment_script
5562 Nicole Meertens Chartered Accountant Bentley Park, QLD 4869 Bentley Park Bentley Park Bentley Park QLD 4869.0 (01) 7403 3021 https://www.nicolemeertens-ca.com.au/ contact@nicolemeertens-ca.com.au 74 775 389 390 997595209 Accounting 90.0 Very High Moderate 1.0 5.0 True True So in summary, your business, Nicole Meertens Chartered Accountant, has a strong foundation in key credibility areas. You have a perfect 5-star Google rating, a solid Online Reputation score of 75, and your Business Details and Website Performance scores are both at a respectable 70. This indicates your core listings are accurate and your website is functioning well for visitors. However, significant weaknesses are holding you back. Your Tech Stack score is critically low at 15, suggesting missing or broken tools for tracking visitor behavior and conversions, which makes measuring marketing success impossible. Furthermore, your overall visibility is hampered by an SEO Score of only 60, limiting how easily potential clients can find you online. Our one clear recommendation is to immediately audit and implement proper website analytics and conversion tracking, such as Google Tag Manager. This will unlock the data you need to understand your clients and effectively improve your SEO, turning your strong reputation into measurable growth. website_domain generated 2026-03-21 12:14:55 completed free_enrichment_v1 free_enrichment_script
5563 Ezy Tax Solutions - ISO9001 Quality Certified Public Accountant & Registered Tax Agent 1F Orchid Plaza Shopping Centre, 58 Lake St, Cairns City QLD 4870 1F Orchid Plaza Shopping Centre, 58 Lake St Cairns City Cairns QLD 4870.0 999999977 https://ezytaxsolutions.com.au contact@ezytaxsolutions.com.au 68 406 582 437 236034795 Accounting 90.0 Very High Strong 10.0 3.0 True True So in summary, Ezy Tax Solutions - ISO9001 Quality Certified Public Accountant & Registered Tax Agent has a presence in Cairns City's area with a 3-star rating and 10 reviews. The overall score of 71 reflects a well-rounded digital presence. The conversion rate is very high at 90, making this an excellent prospect. We could easily help you to improve this, let's talk about it. Ezy Tax Solutions - ISO9001 Quality Certified Public Accountant & Registered Tax Agent is a professional accounting firm in Cairns City, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 3/5 with 10 reviews. Website available. WordPress, GTM, GA website_domain generated 2026-03-21 12:14:55 completed free_enrichment_v1 free_enrichment_script
5564 Cairns Ezytax 1-21 McLeod St, Cairns City QLD 4870 1-21 McLeod St Cairns City Cairns QLD 4870.0 (07) 4031 3932 https://www.cairnsezytax.com.au cairnsezytax@company.com.au 73 977 279 966 250578378 Accounting 90.0 Very High Moderate 10.0 2.6 True True So in summary, your business, Cairns Ezytax, has a solid foundation in its core online listings, achieving a perfect 100 score there, ensuring good basic visibility for both B2B and B2C clients in Cairns. Your business details are also well-maintained at 80, and your website performance is reasonably strong at 70. However, your online presence faces significant critical weaknesses. Your tech stack is severely underdeveloped at only 15, meaning you likely lack essential tools for tracking conversions, analysing customer behaviour, and automating marketing. Furthermore, your online reputation is a major risk with a low Google rating of 2.6 stars from just 10 reviews, which actively deters potential clients, and your SEO score of 60 indicates missed opportunities for organic search growth. My primary recommendation is to immediately implement a structured review generation campaign to address your reputation, while concurrently auditing and installing fundamental marketing technology like Google Analytics 4 and a CRM to track leads and improve client follow-up, as fixing these two areas will directly impact conversion and trust. generated_from_name generated_from_name generated 2026-03-21 12:14:55 completed free_enrichment_v1 free_enrichment_script
5565 Barron Tax & Finance Unit 1/39 Stratford Parade, Stratford QLD 4870 Unit 1/39 Stratford Parade Stratford Cairns QLD 4870.0 (07) 4058 2528 https://barrontax.com.au info@barrontax.com.au 0408 019 273 30 517 124 733 Accounting 78.0 More Likely Strong 10.0 4.8 True True So in summary, Barron Tax & Finance has a strong foundation in Stratford's area with a 4.8-star rating and 10 reviews, indicating satisfied clients. The overall score of 77 reflects a well-rounded digital presence. The conversion rate of 78 is strong, indicating good potential. To improve, consider upgrading the tech stack. We could easily help you to improve this, let's talk about it. Barron Tax & Finance is a professional accounting firm in Stratford, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 4.8/5 with 10 reviews. Website available. GA generated 2026-03-21 12:14:55 completed free_enrichment_v1 free_enrichment_script
5566 MGI Cairns Pty Ltd. Level 1/225 Sheridan St, Cairns North QLD 4870 Level 1/225 Sheridan St Cairns North Cairns QLD 4870.0 (07) 4047 4000 https://www.mgicairns.com.au info@mgicairns.com.au 61 264 115 246 379936389 Accounting 90.0 Very High Strong 1.0 5.0 True So in summary, your business, MGI Cairns, has a strong foundational online presence. You have an impeccable 5-star Google rating, a high Business Details score of 90 indicating good local directory accuracy, and a solid Website Performance score. This combination suggests clients find you trustworthy and your core service information is readily accessible. Your primary weakness is a critically low Tech Stack score of 35. Relying solely on Google Analytics without more sophisticated conversion tracking means you have no visibility into how visitors interact with your website or what prompts them to contact you. This is a major risk, leaving you unable to measure marketing effectiveness or optimise for leads. My one clear recommendation is to immediately implement a comprehensive conversion tracking setup, starting with Google Tag Manager. This will allow you to track key actions like contact form submissions and phone calls, transforming your website from a passive brochure into a measurable lead generation tool essential for growth. MGI Cairns Pty Ltd. is a professional accounting firm in Cairns North, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. GA generated 2026-03-21 12:14:55 completed free_enrichment_v1 free_enrichment_script
5567 JNR Chartered Accountant 361/361-363 Sheridan St, Cairns North QLD 4870 361/361-363 Sheridan St Cairns North Cairns QLD 4870.0 (07) 4031 1165 https://jnrca.com.au jared@jnrca.com.au 88 893 247 789 501223715 Accounting 84.0 Very High Strong 7.0 5.0 True True So in summary, JNR Chartered Accountant has a strong foundation in Cairns North's area with a 5-star rating and 7 reviews, indicating satisfied clients. The overall score of 81 reflects a well-rounded digital presence. The conversion rate is very high at 84, making this an excellent prospect. To improve, consider building more reviews. We could easily help you to improve this, let's talk about it. JNR Chartered Accountant is a professional accounting firm in Cairns North, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 5/5 with 7 reviews. Website available. WordPress, GTM, GA generated 2026-03-21 12:14:56 completed free_enrichment_v1 free_enrichment_script
5568 Pacifica 280-286 Sheridan St, Cairns City QLD 4870 280-286 Sheridan St Cairns City Cairns QLD 4870.0 (07) 4044 5100 https://www.pacifica-ca.com.au enquiries@pacifica-ca.com.au 75 875 886 933 Accounting 74.0 More Likely Strong 43.0 4.8 True So in summary, Pacifica has a strong foundation in Cairns City's area with a 4.8-star rating and 43 reviews, indicating satisfied clients. The overall score of 80 reflects a well-rounded digital presence. The conversion rate of 74 is strong, indicating good potential. We could easily help you to improve this, let's talk about it. Pacifica is a professional accounting firm in Cairns City, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 4.8/5 with 43 reviews. Website available. GTM, GA generated 2026-03-21 12:14:56 completed free_enrichment_v1 free_enrichment_script
5569 ITP Income Tax Professionals Cairns City 4/31 McLeod St, Cairns City QLD 4870 4/31 McLeod St Cairns City Cairns QLD 4870.0 (07) 4051 4690 https://www.itpqld.com/office/cairns-city contact@itpqld.com 13 346 602 572 399281873 Accounting 85.0 Very High Strong 1.0 4.2 True True So in summary, ITP Income Tax Professionals Cairns City has a solid presence in Cairns City's area with a 4.2-star rating and 1 reviews. The overall score of 69 reflects a well-rounded digital presence. The conversion rate is very high at 85, making this an excellent prospect. To improve, consider upgrading the tech stack, building more reviews. We could easily help you to improve this, let's talk about it. ITP Income Tax Professionals Cairns City is a professional accounting firm in Cairns City, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 4.2/5 with 1 reviews. Website available. GA website_domain generated 2026-03-21 12:14:56 completed free_enrichment_v1 free_enrichment_script
5570 Rapid Tax Refunds Level 1, Suite 6/7-9 Anderson St, Manunda QLD 4870 Level 1, Suite 6/7-9 Anderson St Manunda Cairns QLD 4870.0 (07) 4222 1650 https://www.rapidtaxrefunds.com.au contact@rapidtaxrefunds.com.au 76 394 611 689 560863029 Accounting 79.0 More Likely Strong 4.0 4.8 True True So in summary, Rapid Tax Refunds has a strong foundation in Manunda's area with a 4.8-star rating and 4 reviews, indicating satisfied clients. The overall score of 75 reflects a well-rounded digital presence. The conversion rate of 79 is strong, indicating good potential. To improve, consider building more reviews. We could easily help you to improve this, let's talk about it. Rapid Tax Refunds is a professional accounting firm in Manunda, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 4.8/5 with 4 reviews. Website available. GTM, GA website_domain generated 2026-03-21 12:14:56 completed free_enrichment_v1 free_enrichment_script
5571 Eagle Accounting 18 Minnie St, Cairns City QLD 4870 18 Minnie St Cairns City Edmonton QLD QLD 4870.0 (01) 7404 0203 https://www.eagleaccounting.com.au enquiries@eagleaccounting.com.au 80 422 841 916 837697659 Accounting 47.0 Moderate Strong 59.0 5.0 True True So in summary, your business has a strong foundation for local visibility and trust. You have a perfect Google listing score and an excellent 5-star rating from 59 reviews, giving you powerful social proof. Your online reputation and business details are also well-maintained, which is crucial for attracting both local consumers and other businesses in Cairns. However, a significant weakness is your very low tech stack score of 15, indicating your website likely lacks essential tracking and conversion tools like Google Analytics or Tag Manager. This makes measuring marketing performance and customer journeys nearly impossible. Your SEO is also only average, limiting your reach for broader search queries. Therefore, my top recommendation is to immediately audit and implement core marketing technologies on your website to track visitor behaviour and conversions, which will provide the data needed to systematically improve your SEO and marketing return on investment. Eagle Accounting is a professional accounting firm in Cairns City, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. generated 2026-03-21 12:14:56 completed free_enrichment_v1 free_enrichment_script
5572 ASAP Accounting 6 Winfield St, Whitfield QLD 4870 6 Winfield St Whitfield Whitfield QLD 4870.0 (01) 4176 4601 https://asapaccounting.com.au contact@asapaccounting.com.au +61417646013 66 759 639 733 Accounting 90.0 Very High Moderate 14.0 4.7 True True So in summary, your business, ASAP Accounting, has a solid foundation in local visibility and trust. Your Google My Business listing is perfectly optimized with a 100 score, and you benefit from a strong 4.7-star rating from 14 reviews, which is excellent social proof. Your website is performing adequately at 70, and your online reputation score is healthy. The core business details are well-established, giving local clients in Whitfield confidence. However, a critical weakness is your technology setup, scoring only 15. This severely limits your ability to track marketing performance, understand client interactions, and convert website visitors into leads. Your SEO score of 60 also indicates significant room for improvement in organic search visibility, which is a major risk for attracting new business online without paid advertising. My one clear recommendation is to immediately implement a robust analytics and tracking system, starting with Google Tag Manager, to diagnose site engagement and conversion issues; this foundational fix will directly inform and prioritize all subsequent SEO and website optimization efforts. ASAP Accounting is a professional accounting firm in Whitfield, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. website_domain generated 2026-03-21 12:14:56 completed free_enrichment_v1 free_enrichment_script
5573 BDO (Nth Qld) - Cairns Cairns Corporate Tower, Level 1/15 Lake St, Cairns City QLD 4870 Cairns Corporate Tower, Level 1/15 Lake St Cairns City Cairns QLD 4870.0 (07) 4046 0000 https://www.bdo.com.au/en-au/locations/cairns info.cairns@bdo.com.au 72 629 164 721 Accounting 87.0 Very High Strong 10.0 3.9 True So in summary, BDO (Nth Qld) - Cairns has a presence in Cairns City's area with a 3.9-star rating and 10 reviews. The overall score of 76 reflects a well-rounded digital presence. The conversion rate is very high at 87, making this an excellent prospect. We could easily help you to improve this, let's talk about it. BDO (Nth Qld) - Cairns is a professional accounting firm in Cairns City, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Rated 3.9/5 with 10 reviews. Website available. GTM, GA generated 2026-03-21 12:14:56 completed free_enrichment_v1 free_enrichment_script
5574 CMR Bookkeeping Brinsmead, QLD 4870 Brinsmead Brinsmead Brinsmead QLD 4870.0 999999977 https://www.cmrbookkeeping.com.au cmrbookkeeping@company.com.au 75 933 917 995 Accounting 90.0 Very High Moderate 1.0 5.0 True True So in summary, your business, CMR Bookkeeping, has solid foundations in key areas. Your perfect 5-star Google rating, based on one review, is a powerful trust signal, and your Online Reputation score of 75 is strong. Your Business Details and Listings are reasonably well-managed with a 70 and 65 score respectively, aiding local visibility in Brinsmead for both your B2B and B2C clients. Your primary weakness is a critically underdeveloped technological foundation, with a Tech Stack score of just 15. This major gap suggests your website likely lacks essential tools for tracking visitor behaviour, measuring marketing effectiveness, and converting interest into leads. Furthermore, your moderate SEO score of 60 indicates significant room to improve how you are found online for relevant bookkeeping searches. To address this core risk, you must immediately implement a foundational analytics and tracking system, such as Google Tag Manager. This single action will provide the data you need to understand your audience and make informed decisions to grow, transforming your online presence from a static listing into a measurable business asset. generated_from_name generated_from_name generated 2026-03-21 12:14:56 completed free_enrichment_v1 free_enrichment_script
5575 BFL Tax Professionals Westcourt, QLD 4870 Westcourt Westcourt Westcourt QLD 4870.0 (01) 7403 1269 https://www.bfltaxprofessionals.com.au bfltaxprofessionals@company.com.au 29 421 787 534 Accounting 70.0 More Likely Moderate 29.0 4.9 True True So in summary, your business, BFL Tax Professionals, has a strong foundation in local visibility and client trust. Your excellent 4.9-star Google rating from 29 reviews is a major asset, and your 85 Listings Score indicates your core business information is well-distributed online, making you easy for local clients to find. This is supported by a solid 78 Online Reputation score. However, your digital presence has critical weaknesses that hinder growth. Your Tech Stack Score is critically low at 15, meaning you likely lack essential tracking and conversion tools, making marketing performance a mystery. Furthermore, your 60 SEO score shows significant room for improvement in how you attract organic search traffic, which is a major risk given you serve both individuals and businesses. To address this, my top recommendation is to immediately implement and configure a robust analytics platform like Google Tag Manager to track website interactions and customer journeys. This single action will provide the data needed to systematically improve your SEO, conversion rates, and overall marketing return on investment. generated_from_name generated_from_name generated 2026-03-21 12:14:56 completed free_enrichment_v1 free_enrichment_script
5576 Mastered Tax and Accounting Manunda, QLD 4870 Manunda Manunda Manunda QLD 4870.0 (01) 4669 1161 https://www.masteredtaxandaccounting.com.au katrina@masteredtaxandaccounting.com.au 71 289 631 293 362623063 Accounting 90.0 Very High Strong 23.0 4.5 True True So in summary, your business has a solid foundation with excellent local visibility, evidenced by a perfect 100 Listings Score, which ensures customers can find you. Your strong 4.5-star Google rating from 23 reviews builds crucial trust for both your B2B and B2C clients. Furthermore, your website performance and basic SEO are competent, supporting your core service messaging for tax and accounting in Manunda. However, a critical weakness is your very low Tech Stack Score of 35. Relying solely on basic Google Analytics means you likely lack proper conversion tracking, such as measuring contact form submissions or phone calls. This gap makes it impossible to truly understand which marketing efforts drive client enquiries and revenue, a significant risk for informed decision-making. Our primary recommendation is to immediately implement a robust conversion tracking system, like Google Tag Manager. This single action will allow you to identify your most valuable website traffic and marketing channels, enabling you to strategically invest in what directly grows your business. Mastered Tax and Accounting is a professional accounting firm in Manunda, QLD, Australia offering tax, bookkeeping, BAS and advisory services. Website available. GA generated 2026-03-21 12:14:56 completed free_enrichment_v1 free_enrichment_script
5577 Accountants Direct - Income Tax Accountant Cairns (Phone Only) Manunda, QLD 4870 Manunda Manunda Manunda QLD 4870.0 999999977 https://www.accountantsdirectincometaxaccountantcairnsphoneonly.com.au accountantsdirectincometaxaccountantcairnsphoneonly@company.com.au 56 257 851 605 396629003 Accounting 47.0 Moderate Moderate 49.0 5.0 True True So in summary, your business, Accountants Direct, demonstrates a strong foundation for trust and local visibility in Cairns. Your exceptional 5-star Google rating from 49 reviews is a major asset, and your high Listings Score of 85 shows your core business information is well-distributed online. This gives you excellent credibility and a solid base for local search. Your primary weakness is a critically low Tech Stack Score of 15, indicating a severe lack of essential marketing and analytics tools. This makes your website's decent performance and SEO potential untrackable and unoptimised. You are effectively operating in the dark, unable to measure what drives calls or convert interest from your good online reputation. To unlock growth, you must immediately implement core tracking. Install and configure Google Analytics 4 and Google Tag Manager on your website. This single action will provide the data you need to understand client behaviour, measure marketing effectiveness, and make informed decisions to improve your return on investment. generated_from_name generated_from_name generated 2026-03-21 12:14:57 completed free_enrichment_v1 free_enrichment_script
5578 Findex Cairns Earlville, QLD 4870 Earlville Earlville Earlville QLD 4870.0 (01) 7405 2322 https://www.findex.com.au/office/cairns?utm_source=gmb&utm_medium=organic&utm_campaign=brand+general&utm_content=cairns contact@findex.com.au 48 583 890 621 Accounting 90.0 Very High Moderate 10.0 3.4 True So in summary, your business, Findex Cairns, has established a solid foundational online presence. Your Google Business Profile listings are strong with an 85 score, ensuring good local visibility, and your website performance is adequate at 70. You have a base of 10 Google reviews, which provides some social proof for potential clients. However, significant weaknesses are holding you back. The very low 3.4-star rating indicates a reputation problem that deters potential clients. Your tech stack score is critically low at 15, suggesting missing tracking and analytics, which means you are likely flying blind on how visitors use your site. Furthermore, your SEO score of 60 shows room for improvement to rank higher in search results. My primary recommendation is to immediately launch a proactive review generation campaign. Systematically ask satisfied clients for Google reviews to improve your average rating and volume, directly addressing your biggest conversion barrier. Boosting your online reputation is the most urgent step to convert visibility into trust and new business. website_domain generated 2026-03-21 12:14:57 completed free_enrichment_v1 free_enrichment_script
5579 Acumen Accounting & Advisory Westcourt, QLD 4870 Westcourt Westcourt Westcourt QLD 4870.0 (01) 7405 1479 https://www.acumenaa.com.au/?utm_source=google&utm_medium=organic&utm_campaign=gmb contact@acumenaa.com.au 50 512 512 175 382198129 Accounting 90.0 Very High Moderate 8.0 4.3 True True So in summary, your business, Acumen Accounting Advisory, has a solid foundation with a good Google rating of 4.3 stars from 8 reviews and a strong Listings Score of 85, indicating your local visibility in Westcourt is well-managed. Your website performance and business details are also reasonably sound at 70. However, the data reveals critical weaknesses. Your Tech Stack Score is critically low at 15, suggesting missing or broken tools for tracking conversions and user behaviour, which cripples your ability to measure marketing ROI. Combined with a moderate SEO Score of 60, this means you are likely missing valuable leads. My primary advice is to immediately audit and implement a proper analytics and conversion tracking setup, starting with Google Tag Manager, to understand how clients find you and what actions they take, turning your visibility into measurable growth. website_domain generated 2026-03-21 12:14:57 completed free_enrichment_v1 free_enrichment_script
5580 HYF Accounting & Advisory Westcourt, QLD 4870 Westcourt Westcourt Westcourt QLD 4870.0 (01) 7404 1774 https://hyfaa.com.au/ contact@hyfaa.com.au 68 428 572 358 207884076 Accounting 90.0 Very High Moderate 1.0 5.0 True True So in summary, your business, HYF Accounting Advisory, has a solid foundation to build upon. Your excellent 5-star Google rating, based on one review, is a powerful trust signal. Your Business Details and Website Performance scores are reasonably strong at 70, suggesting good core information and a functional site. Your Online Reputation score of 75 also indicates a positive starting point. However, your Tech Stack score is critically low at 15, meaning you likely lack essential tracking and analytics tools to understand client behavior. Your SEO score of 60 shows room for improvement in visibility, and having only one review is a major risk, as it makes your reputation appear fragile and limits social proof. Your single most impactful action is to implement a robust analytics and conversion tracking system, like Google Tag Manager, immediately. This will reveal how clients find and use your site, allowing you to strategically invest in areas that directly drive growth. website_domain generated 2026-03-21 12:14:57 completed free_enrichment_v1 free_enrichment_script
5581 Caatz Management Rights Accountants Westcourt, QLD 4870 Westcourt Westcourt Westcourt QLD 4870.0 999999977 https://www.caatzmanagementrightsaccountants.com.au caatzmanagementrightsaccountants@company.com.au 26 228 737 619 233044297 Accounting 82.0 Very High Moderate 14.0 5.0 True True So in summary, your business has a strong foundation in reputation and local visibility. Your perfect 5-star Google rating from 14 reviews is a major asset, and your Listings Score of 85 indicates your core business information is well-distributed online. Your Website Performance and Business Details scores are also solid, showing good basic presentation. However, your Tech Stack Score is critically low at 15, meaning you likely lack essential tracking and analytics tools to understand visitor behavior. Your SEO Score of 60 also suggests significant room for improvement in how you are found for relevant searches, which is a major risk for generating qualified leads. My one clear recommendation is to immediately implement and configure a robust analytics platform like Google Tag Manager to track conversions and user journeys, as this data is essential to systematically improve your SEO and marketing ROI. generated_from_name generated_from_name generated 2026-03-21 12:14:57 completed free_enrichment_v1 free_enrichment_script
5582 Cairns Accounting & Tax Specialists Manunda, QLD 4870 Manunda Manunda Manunda QLD 4870.0 (01) 7405 3300 https://www.cairnsaccountingandtaxspecialists.com.au cairnsaccountingandtaxspecialists@company.com.au 41 719 532 338 120396171 Accounting 90.0 Very High Moderate 6.0 4.3 True True So in summary, your business has a solid foundation for local visibility, with strong Google Business Profile management reflected in your high Listings Score of 85 and a good Google Rating of 4.3 stars. Your Business Details and Website Performance scores are also reasonably strong at 70, suggesting your core service information is accessible and your site is functional for visitors. However, your primary weakness is a critically low Tech Stack Score of 15, which severely limits your ability to track visitor behavior, measure marketing effectiveness, and convert interest into leads. This gap, coupled with a middling SEO Score of 60, means you are likely missing significant online opportunity and cannot reliably see what is or isn't working. My top recommendation is to immediately implement and configure core web analytics and tracking tools, such as Google Analytics 4 and Google Tag Manager, to diagnose site engagement and start converting your good visibility into measurable client inquiries. generated_from_name generated_from_name generated 2026-03-21 12:14:57 completed free_enrichment_v1 free_enrichment_script
5583 Phillips Accountants Manunda, QLD 4870 Manunda Manunda Manunda QLD 4870.0 (01) 7403 1646 https://www.phillipsaccountants.com.au/ contact@phillipsaccountants.com.au 91 281 865 595 Accounting 90.0 Very High Moderate 1.0 4.0 True True So in summary, your business, Phillips Accountants, has a solid foundation with a good Google rating of 4 stars. Your business details and listings are reasonably well-managed with scores of 70 and 65, and your website performance and basic SEO are acceptable at 70 and 60. This indicates decent local visibility and a professional online starting point for both your B2B and B2C clients in Manunda. However, the data reveals critical weaknesses. Your Tech Stack score is alarmingly low at 15, suggesting missing or broken tools for tracking conversions, marketing analytics, and potentially client interactions. This makes measuring marketing effectiveness nearly impossible. Furthermore, your overall Online Reputation score of 61 is vulnerable, likely due to having only a single review. My strongest advice is to immediately audit and implement core marketing technology, starting with proper tracking via Google Tag Manager and analytics. This one step will unlock data to understand client behavior, measure what drives leads, and make informed decisions to systematically grow your practice. website_domain generated 2026-03-21 12:14:57 completed free_enrichment_v1 free_enrichment_script
5584 AnA Accounting & Tax Services Manunda, QLD 4870 Manunda Manunda Manunda QLD 4870.0 (01) 7404 1122 https://ana-accounting.com.au/ contact@ana-accounting.com.au 21 101 954 178 054283245 Accounting 90.0 Very High Moderate 1.0 5.0 True True So in summary, your business, AnA Accounting Tax Services, has a solid foundation with a perfect 5-star Google rating and a strong online reputation score of 75. Your business details are largely accurate with a 70 score, and your website performance is reasonably good at 70. This indicates you are visible and trusted locally in Manunda for both individual and business clients. However, your tech stack score is critically low at 15, meaning you likely lack essential marketing and analytics tools like Google Tag Manager. This makes tracking conversions and understanding customer behaviour impossible. Furthermore, your SEO score of 60 and listings score of 65 reveal significant gaps in local search visibility and consistency, which hinders growth. You must immediately implement a core analytics tool, such as Google Tag Manager, on your website. This single action will unlock the data you need to measure marketing effectiveness and make informed decisions to attract more clients. website_domain generated 2026-03-21 12:14:57 completed free_enrichment_v1 free_enrichment_script
5585 Hains Accounting & Taxation Manunda, QLD 4870 Manunda Manunda Manunda QLD 4870.0 (01) 7403 2300 https://www.hainstax.com/ contact@hainstax.com 74 950 953 698 Accounting 90.0 Very High Moderate 5.0 4.2 True True So in summary, your business, Hains Accounting Taxation, has established a solid foundation for client trust and local visibility. Your strong 4.2-star Google rating from 5 reviews is a key asset, and your Business Details and Listings scores of 70 and 65 respectively show good local directory consistency. Your website performance is also reasonably strong at 70. However, a significant weakness is your very low Tech Stack score of 15, indicating critical gaps in tools for tracking marketing performance and user behaviour, which leaves you operating blindly online. Furthermore, your SEO score of 60 and Online Reputation score of 63 reveal untapped potential for greater visibility and review management. My strongest recommendation is to immediately implement and configure a robust analytics platform, such as Google Tag Manager, to track website conversions and user journeys, providing the data needed to make informed marketing decisions and systematically improve your other scores. website_domain generated 2026-03-21 12:14:57 completed free_enrichment_v1 free_enrichment_script
5586 Jennifer Frusher Chartered Accountant Freshwater QLD, QLD 4870 Freshwater Freshwater QLD Freshwater QLD QLD 4870.0 (01) 7404 1117 https://www.jafrusher.com.au/ contact@jafrusher.com.au 47 581 487 604 631397675 Accounting 90.0 Very High Moderate 2.0 3.0 True True So in summary, your business, Jennifer Frusher Chartered Accountant, has a solid operational foundation online. Your business details score of 70 and listings score of 65 indicate your core contact information is accurately listed across key directories, aiding local discovery in Freshwater. Your website performance is also a relative strength at 70, suggesting decent loading times for visitors. However, significant risks are holding you back. Your online reputation is a critical weakness, with a low score of 47 and a Google rating of just 3 stars from only 2 reviews, which undermines trust for both B2B and B2C clients. Furthermore, your tech stack score is severely low at 15, meaning you likely lack essential tracking and analytics tools to understand client behaviour and measure marketing effectiveness. To immediately build credibility and generate social proof, you must proactively implement a structured client review strategy. Actively request reviews from satisfied clients to improve your rating and volume, which is the single most impactful action to convert your existing visibility into new enquiries. website_domain generated 2026-03-21 12:14:58 completed free_enrichment_v1 free_enrichment_script
5587 Temp Accounting & Admin Pty Ltd Freshwater QLD, QLD 4870 Freshwater Freshwater QLD Freshwater QLD QLD 4870.0 (01) 7405 7738 https://www.tempaccounting.com.au/ contact@tempaccounting.com.au 59 187 884 553 Accounting 90.0 Very High Moderate 1.0 5.0 True True So in summary, your business, Temp Accounting Admin, has a solid foundation with a perfect 5-star Google rating, which is a powerful trust signal for both local clients and businesses. Your online reputation score of 75 and business details accuracy of 70 show good local visibility and reliable core information. The website performance is also reasonably strong at 70. However, your tech stack score is critically low at 15, indicating a severe lack of essential marketing and analytics tools, which means you cannot track visitor behavior or campaign effectiveness. Your SEO score of 60 also suggests significant room for improvement in how you are found online for key accounting services in Freshwater. My primary advice is to immediately implement a foundational analytics setup, such as Google Tag Manager, on your website. This single action will unlock the data you need to understand your audience and make informed decisions to grow, turning your online presence from a static brochure into a measurable business asset. website_domain generated 2026-03-21 12:14:58 completed free_enrichment_v1 free_enrichment_script
5588 David Williams Chartered Accountant Freshwater QLD, QLD 4870 Freshwater Freshwater QLD Freshwater QLD QLD 4870.0 (01) 4115 9856 https://www.davidwilliamscharteredaccountant.com.au davidwilliamscharteredaccountant@company.com.au +61411598562 35 406 200 971 718368004 Accounting 90.0 Very High Moderate 2.0 5.0 True True So in summary, your business, David Williams Chartered Accountant, has a solid foundation with a perfect 5-star Google rating, which is a powerful trust signal for both local individuals and other businesses. Your business details and listings are reasonably well-managed with a 70 and 65 score respectively, aiding local visibility. Your website performance and SEO are also at a competent baseline. However, your primary weakness is a critically underdeveloped technology infrastructure, scoring only 15. This major gap likely means you lack essential tools for tracking leads, analysing website visitors, and automating client communication. It represents a significant risk to understanding your marketing effectiveness and converting interest into clients. My strongest recommendation is to immediately implement a core tech stack, starting with a functional website if absent, and integrating tools like Google Analytics and a CRM. This single action will unlock your ability to measure, optimise, and grow your practice efficiently. generated_from_name generated_from_name generated 2026-03-21 12:14:58 completed free_enrichment_v1 free_enrichment_script
5589 Smart Bookkeeping Payroll & BAS Stratford QLD, QLD 4870 Stratford Stratford QLD Stratford QLD QLD 4870.0 (01) 4284 1105 https://smartbookkeeping.au/ contact@smartbookkeeping.au +61428411050 15 512 647 278 963164293 Accounting 90.0 Very High Moderate 5.0 4.2 True True So in summary, your business, Smart Bookkeeping Payroll BAS, has a solid foundation. Your strong 4.2-star Google rating from 5 reviews is a key asset, building trust with both local and business clients. Furthermore, your Business Details and Listings scores of 70 and 65 respectively indicate a reasonably complete and consistent online presence, which aids local visibility. Your website performance is also a relative strength at 70. However, a critical weakness is your severely underperforming Tech Stack, scoring only 15. This major gap likely means missing essential tools for tracking conversions, analysing visitor behaviour, and running effective digital campaigns. Your SEO score of 60 also suggests room for improvement in attracting organic search traffic through better content and keyword optimisation. To address this core weakness, my primary recommendation is to immediately audit and implement a professional tech stack, starting with proper analytics and conversion tracking installation, to transform your website from a digital brochure into a measurable growth engine. website_domain generated 2026-03-21 12:14:58 completed free_enrichment_v1 free_enrichment_script
5590 LJM Business Solutions Stratford QLD, QLD 4870 Stratford Stratford QLD Stratford QLD QLD 4870.0 (01) 4199 3677 https://www.ljmbusinesssolutions.com.au ljmbusinesssolutions@company.com.au +61419936776 62 676 406 488 Accounting 90.0 Very High Moderate 4.0 5.0 True So in summary, your business, LJM Business Solutions, demonstrates a solid foundation in key areas. You have an excellent Google Rating of 5 stars from your reviews, which is a powerful trust signal for potential clients. Your business details and listings are reasonably well-managed with a 65 score, aiding local visibility in Stratford, and your website performance and SEO are at a competent baseline. However, the data reveals critical gaps that hinder growth. Your tech stack score is critically low at 15, indicating a severe lack of essential marketing and analytics tools on your website, such as tracking pixels or chatbots. This makes measuring performance and converting visitors nearly impossible. Furthermore, the absence of a live website is your single largest risk, completely preventing online service inquiries and lead generation. Therefore, your immediate priority must be to launch a professional, functional website. This foundational asset will allow you to implement tracking, capture leads, and fully leverage your strong local reputation. generated_from_name generated_from_name generated 2026-03-21 12:14:58 completed free_enrichment_v1 free_enrichment_script
5591 Drescher Accounting Manunda, QLD 4870 Manunda Manunda Manunda QLD 4870.0 (01) 7405 3577 https://drescheraccounting.com.au/?utm_source=google&utm_medium=organic&utm_campaign=gmb contact@drescheraccounting.com.au 99 807 950 119 Accounting 90.0 Very High Moderate 2.0 5.0 True True So in summary, your business, Drescher Accounting, has a solid foundation with a perfect 5-star Google rating, a strong online reputation score of 75, and a respectable website performance of 70. Your Business Details and Listings scores are adequate, indicating good local visibility in Manunda. However, the data reveals a critical weakness in your technical setup, with a very low Tech Stack score of just 15. This severely limits your ability to track visitor behavior, measure marketing effectiveness, and likely impacts your overall conversion readiness. Furthermore, your SEO score of 60 suggests there is significant room to improve your content and site structure to attract more organic search traffic. To immediately address the biggest gap, I strongly recommend implementing a proper analytics and tracking system, like Google Tag Manager, on your website to start collecting actionable data on your visitors and campaign performance. website_domain generated 2026-03-21 12:14:58 completed free_enrichment_v1 free_enrichment_script
5592 JGM Accountants Brinsmead, QLD 4870 Brinsmead Brinsmead Brinsmead QLD 4870.0 (01) 7405 1531 https://www.jgmtax.com.au/ contact@jgmtax.com.au 25 879 842 215 531407263 Accounting 90.0 Very High Moderate 4.0 5.0 True True So in summary, your business, JGM Accountants, has a solid foundation with clear strengths. You enjoy an excellent 5-star Google rating from your clients, which is a powerful trust signal. Your business details and online listings are reasonably complete at 70 and 65 respectively, aiding local visibility in Brinsmead, and your website performance is acceptable. Your main weakness is a critically low Tech Stack score of 15, indicating you are likely missing essential tracking and analytics tools like Google Tag Manager. This makes it impossible to measure marketing effectiveness or understand client behaviour on your website. Furthermore, your SEO score of 60 suggests untapped potential for attracting more organic search traffic. You should immediately implement and configure a proper analytics and conversion tracking setup on your website. This single action will provide the data needed to make informed decisions to grow your practice. website_domain generated 2026-03-21 12:14:58 completed free_enrichment_v1 free_enrichment_script
5593 Kuranda Village Accountancy Kanimbla, QLD 4870 Kanimbla Kanimbla Kanimbla QLD 4870.0 (01) 7409 3822 https://www.kurandavillageaccountancy.com.au/ contact@kurandavillageaccountancy.com.au 98 384 328 493 132859382 Accounting 90.0 Very High Moderate 3.0 5.0 True True So in summary, your business, Kuranda Village Accountancy, has a strong foundation in local visibility and reputation. Your excellent 5-star Google rating, though based on only 3 reviews, indicates high client satisfaction. Your business details score of 70 and listings score of 65 show your core information is largely accurate and present across key directories, aiding local discovery. Your website performance is also solid at 70. However, your primary weakness is a critically low Tech Stack score of 15, which severely hampers your ability to convert website visitors into leads and track marketing performance. This gap suggests missing tools like analytics, chatbots, or contact form tracking. Furthermore, your SEO score of 60 indicates room for improvement in how you attract organic search traffic from potential clients in Kanimbla and beyond. My top recommendation is to immediately audit and implement essential conversion and tracking technologies on your website. Installing tools like Google Analytics, a live chat widget, and proper contact form tracking would directly address your biggest conversion readiness gap and provide the data needed to fuel further growth. website_domain generated 2026-03-21 12:14:58 completed free_enrichment_v1 free_enrichment_script
5594 Coral Coast Accounting Kanimbla, QLD 4870 Kanimbla Kanimbla Kanimbla QLD 4870.0 (01) 7408 4038 https://www.coralcoastaccounting.com.au coralcoastaccounting@company.com.au 16 120 794 271 Accounting 90.0 Very High Moderate 1.0 5.0 True True So in summary, your business, Coral Coast Accounting, has a strong foundation for client trust in Kanimbla, with a perfect 5 Google rating and a solid 75 Online Reputation score. Your Business Details and Listings are reasonably complete at 70 and 65 respectively, aiding local visibility, and your Website Performance is a relative strength at 70. However, a critical weakness is your severely underdeveloped Tech Stack, scoring only 15. This indicates you likely lack essential marketing and analytics tools like Google Tag Manager, which prevents you from tracking website conversions and understanding client behaviour. Your SEO score of 60 also suggests room for improvement in how you attract organic search traffic. To unlock growth, you must immediately implement a core analytics and conversion tracking system on your website; this single action will provide the data needed to make informed decisions that directly improve your marketing return on investment. generated_from_name generated_from_name generated 2026-03-21 12:14:58 completed free_enrichment_v1 free_enrichment_script
5595 Caldwell Accounting Whitfield, QLD 4870 Whitfield Whitfield Whitfield QLD 4870.0 (01) 7320 2555 https://johncaldwell.com.au/ contact@johncaldwell.com.au 78 771 463 733 Accounting 90.0 Very High Moderate 3.0 5.0 True True So in summary, your business has a solid foundation in several key areas. You have an excellent Google Rating of 5 stars, a strong Online Reputation score of 75, and your Business Details and Listings are reasonably well-maintained at 70 and 65 respectively. Your website performance is also adequate at 70. This indicates good visibility and trust with your local audience in Whitfield. However, the data reveals a critical vulnerability: your Tech Stack score is extremely low at 15. This major weakness means your website likely lacks essential marketing, tracking, and conversion tools like Google Analytics or Tag Manager. Without these, you cannot measure visitor behavior, run effective ads, or understand what drives leads, making growth difficult. Therefore, my top priority recommendation is to immediately audit and implement a core marketing technology stack, starting with proper analytics and conversion tracking, to turn your website traffic into measurable business growth. website_domain generated 2026-03-21 12:14:58 completed free_enrichment_v1 free_enrichment_script
5596 Vipiana & Associates Earlville, QLD 4870 Earlville Earlville Earlville QLD 4870.0 (01) 7405 4377 https://www.vipiana.com.au/ contact@vipiana.com.au 65 319 193 157 Accounting 90.0 Very High Moderate 7.0 4.6 True So in summary, your business, Vipiana Associates, has established a solid foundation for local visibility. You have a strong Google Rating of 4.6 stars from 7 reviews, and your Listings Score of 85 indicates your core business information is well-distributed online, helping clients in Earlville find you. Your website performance and business details are also reasonably solid. However, the data reveals critical technical weaknesses that are likely hindering growth. Your Tech Stack Score is extremely low at 15, suggesting missing or broken tracking tools like Google Analytics or Tag Manager. This makes measuring marketing effectiveness impossible. Furthermore, your SEO Score of 60 shows untapped potential to attract more organic search traffic. My primary recommendation is to immediately audit and implement a complete marketing technology stack. Installing and configuring proper tracking is the essential first step to diagnose website issues, understand client acquisition, and make data-driven decisions to improve your SEO and conversion rates. website_domain generated 2026-03-21 12:14:59 completed free_enrichment_v1 free_enrichment_script
5597 Beate Fritzsch Accounting Freshwater QLD, QLD 4870 Freshwater Freshwater QLD Freshwater QLD QLD 4870.0 (01) 4571 6693 https://www.facebook.com/fritzschaccounting contact@facebook.com +61457166931 81 107 946 927 Accounting 90.0 Very High Moderate 1.0 5.0 True True So in summary, your business has a strong reputation foundation with a perfect 5 Google rating, and your core business details and online listings are reasonably well-established with a 65 score. Your Facebook page is functioning as your primary web presence with decent performance, and your online reputation score of 75 is a solid asset. However, the critique is that your business is severely limited by its technology. Relying solely on a Facebook page sacrifices professional credibility and control, directly shown by your very low 15 Tech Stack score. This lack of a proper website critically damages your Search Engine Optimisation (SEO), hindering how easily new clients can find you organically, and provides no platform for detailed service information or client conversion tools. My primary advice is to immediately invest in a professional, standalone website; this single action will centralise your information, dramatically improve your SEO and tech score, and convert your strong reputation into measurable business growth. website_domain generated 2026-03-21 12:14:59 completed free_enrichment_v1 free_enrichment_script
5598 360 Accounting - Accounting, Taxation, Bookkeeping Freshwater QLD, QLD 4870 Freshwater Freshwater QLD Freshwater QLD QLD 4870.0 (01) 4216 6809 https://www.threesixtyaccounting.com.au/ contact@threesixtyaccounting.com.au +61421668096 64 463 540 306 144472705 Accounting 90.0 Very High Moderate 2.0 3.8 True True So in summary, your business has established a credible professional foundation online. Your business details are well-populated with a 70 score, and your website performance is solid at 70, suggesting a functional and informative site. Your Google My Business listings are also in good shape at 65, which aids local visibility for both your B2B and B2C clients in Freshwater. However, your online presence has significant vulnerabilities. Your tech stack score is critically low at 15, indicating missing or broken tools for tracking marketing performance and user behaviour. Furthermore, your online reputation score of 58 and modest 3.8-star rating from only 2 reviews represent a major trust gap that can deter potential clients. My primary recommendation is to immediately audit and correctly implement foundational analytics and tracking, such as Google Tag Manager, to understand your customer journey, then launch a structured program to proactively generate positive client reviews. This dual action will provide the data to make smarter marketing investments and directly boost your conversion credibility. website_domain generated 2026-03-21 12:14:59 completed free_enrichment_v1 free_enrichment_script
5599 Nortax Accountants & Advisors Freshwater QLD, QLD 4870 Freshwater Freshwater QLD Freshwater QLD QLD 4870.0 (01) 7403 4229 https://www.nortax.com.au/ contact@nortax.com.au 65 210 261 413 460846586 Accounting 90.0 Very High Moderate 3.0 5.0 True True So in summary, your business, Nortax Accountants Advisors, has established a strong foundation for trust and local visibility. You have a perfect Google Rating of 5 stars, a high Online Reputation score of 75, and solid Business Details and Listings scores, which help clients find and choose you. Your website performance is also reasonably strong at 70. However, the data reveals a critical weakness in your technical setup, with a very low Tech Stack score of 15. This major gap likely means you are missing essential tracking and conversion tools, hindering your ability to understand client behaviour and measure marketing success. Your SEO score of 60 also indicates room for improvement to attract more organic search traffic. My primary recommendation is to immediately audit and implement a proper marketing technology stack, starting with Google Tag Manager and analytics, to track conversions and user journeys. This single action will provide the data needed to systematically improve your SEO and online performance. website_domain generated 2026-03-21 12:14:59 completed free_enrichment_v1 free_enrichment_script
5600 Grant Thornton Australia Ltd Westcourt, QLD 4870 Westcourt Westcourt Westcourt QLD 4870.0 (01) 7322 2020 https://www.grantthornton.com.au/ contact@grantthornton.com.au 89 433 382 486 Accounting 90.0 Very High Moderate 50.0 3.8 True So in summary, your business, Grant Thornton Australia, demonstrates a solid foundation for local visibility with a strong Listings Score of 85, ensuring your firm is well-presented in key directories. Your Website Performance and Business Details scores are also respectable at 70, indicating a functional core online presence. However, a critical weakness is your extremely low Tech Stack Score of 15, which strongly suggests major gaps in conversion tracking, analytics, and potentially site functionality. This is a severe risk as it makes measuring marketing ROI and understanding client behavior nearly impossible. Furthermore, your SEO Score of 60 and Online Reputation score of 63 indicate significant room for improvement in organic search visibility and proactive review management. My primary recommendation is to immediately conduct a full audit and implementation of core marketing technologies, starting with proper analytics and tag management systems, to unlock data-driven growth. website_domain generated 2026-03-21 12:14:59 completed free_enrichment_v1 free_enrichment_script